(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE10

ASFUM1_6.PE10        Location/Qualifiers
FT   CDS_pept        join(complement(66332..66958),complement(64585..66261),
FT                   complement(64415..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000217679" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262207"
FT                   /orf_name="AFUA_6G00200"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84245.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056496"
FT                   /db_xref="HOGENOM:HBG327554"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E68F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X4"
FT                   /transl_table=1
FT                   /translation="MAQDQDNFPRTTSPPRKRRRPPKSCDPCRRRKVRCDREVPCGPCQ
FT                   RARTSLHCFYRPAVTARSPSTDEDCRLTASCGPEGHTPPPQAVDLQTKIRPAAPTAQSQ
FT                   PQGPNYDQTKIIQDLQNRVRRLEEQLCDLPLSKGAIGPNPSVSPSQALRHLHDRVRGAE
FT                   QQLSDASRPSPSVNGWTIPTTLPRLRIAPNKTKLFGPSHWLHTAEKFQVIGKFDAKEVE
FT                   PSLQDVDTRSEFASIFKDCRQLRQAIKDQESVRLNHPVPDLLGTLPTQAVCDVLVNAYL
FT                   RTFELIYRVIHIPSFWKEYRQLWTQPQSTATSFLMKLVLILALGTTFHPDRNNRVHLRR
FT                   LAHTWIYAAQWWLVGPSEKSTVNLDGLQVGCLLLLARQTNSLPATSWLSAGSVLRMAMA
FT                   MGLHRSPDHFPALSGYQSEMRARLWATVLELTLLSSLDASMPLPFSLEDFDCTAPSNAN
FT                   DEQFDPEAETLPTPQSNEHFTDSSIQILLLKCLQSRVEAVQLLNNQHGRELSYETALRL
FT                   GNELRSACRDIAALFHTSQNQPKQGGRTPGMTDFHLRFLDMYLRRYILFLHRPFMMKAR
FT                   TDPRFYLSRKVCLESCIVIASYAEHLNLPSDTLDDISHLTIVGRGSFKGALSFDVITSL
FT                   GLEIITQLEEEASTRSVGTPAPIIADPLDKMAKAHREPLIRSLEHIQKQLLQIIALGQP
FT                   SLKRYNFLSAILSQIRAMESGQPIQPAIYETVKESLRKSYSLLQASHAARRAQDSVESL
FT                   NMGTDSPLGFDLDALDPALGLEIPSLLFFPGIMNTLSTDVSNQCYN"
     atggcacagg atcaggacaa tttcccgcgg accacatctc cacctcgcaa acgtcgccga        60
     ccccccaagt cctgtgaccc gtgccgtcgt cgcaaagtcc gttgtgacag ggaggttcct       120
     tgcggcccat gccagcgtgc gagaacgtcg ctgcactgtt tttaccgccc cgcagtcact       180
     gccagaagcc catccacaga cgaagactgc aggctcacgg cttcttgtgg gccggaggga       240
     catacacctc ctccccaagc cgttgacctg cagacgaaga tccgtccagc agcacccaca       300
     gcgcaatcgc agcctcaggg tccgaattac gatcaaacca agatcatcca ggatctgcaa       360
     aatcgtgttc ggcgtttgga ggaacagctt tgcgaccttc cgctctctaa aggcgcgatc       420
     ggtcccaatc ccagcgtctc tccaagtcag gctctgcgcc accttcacga ccgggttcgt       480
     ggagccgaac aacagctgtc tgatgcatct cggcccagtc cttcggtcaa tggatggacc       540
     ataccgacca cgcttcctcg tctgcgtatc gccccgaata aaacgaagct ttttggcccc       600
     agtcactggc tgcataccgc tgagaaattt caagttattg gcaaattcga cgccaaagaa       660
     gtagaaccat cgctgcagga cgtggatacc agatcggagt tcgccagcat cttcaaggac       720
     tgtcgacaac ttcggcaggc catcaaggac caagagtcgg ttcgtctcaa ccatccggtt       780
     ccggacttgc tgggcacgct ccccacccaa gcagtctgtg atgtgctcgt caatgcctat       840
     ctccgcactt tcgagcttat ctaccgtgtt atccatatcc catccttctg gaaagagtat       900
     cgtcagctgt ggacccagcc gcagtcgacc gcgacctctt ttctgatgaa actggtcttg       960
     attctcgcgc tgggtactac attccaccca gatcgaaaca atagggtgca tctccgccgt      1020
     ctcgcacaca cgtggatcta tgccgcacaa tggtggctag tcggaccatc ggaaaagtcg      1080
     actgtcaatc tggatggcct gcaggtcggt tgtctcctat tattggcccg ccagacaaat      1140
     agcctcccgg ctacgagctg gctctctgca gggtctgtgc tacgtatggc gatggcgatg      1200
     gggctccacc gctctcccga ccactttccc gccctgtccg gttaccagtc cgaaatgcga      1260
     gctcgactct gggcgacagt gctggaattg actctactgt catcgctgga tgcctccatg      1320
     ccattaccct tctccctaga ggactttgac tgcacggcgc cgtccaacgc gaatgacgag      1380
     cagtttgacc ccgaggccga gacgcttccc accccgcagt cgaatgagca cttcaccgac      1440
     tcgtccattc agattttgtt gcttaagtgt cttcagtcgc gagtggaagc agtccagctt      1500
     ctgaacaacc agcacggccg ggaattgtca tacgaaaccg cactgaggtt gggaaacgaa      1560
     ttgcgctcgg cgtgccgcga tattgcggcc ttgttccaca ccagtcaaaa tcagccaaag      1620
     caagggggcc gcactccggg catgactgac ttccatctcc gatttttaga catgtaccta      1680
     cgtcgatata tcctgttcct gcatcggccg tttatgatga aagctcgtac agacccacga      1740
     ttctacctgt cccggaaggt gtgcctggag tcctgcatcg tgattgcatc gtatgccgaa      1800
     catctcaatc taccatccga caccttggat gacatctccc acctgaccat tgtaggaaga      1860
     ggctccttca aaggtgcctt gagctttgat gtgatcacct ccctggggct ggaaataatc      1920
     acgcagcttg aagaggaggc ttctacacga tccgtgggaa cccctgcccc aattatcgcc      1980
     gatcctctcg ataagatggc caaggcccat cgagagccct tgatccggag cctggagcat      2040
     attcaaaagc agctgctgca gatcattgcc ctcggacagc ccagtctcaa gcgatacaac      2100
     ttcctgtccg ccatcttgag tcagatccgt gcaatggagt cgggccagcc gatccaaccc      2160
     gctatttatg agaccgtcaa agaaagcctg aggaagagtt attctttgct gcaggcctct      2220
     cacgcagctc gtcgggcgca ggactcggtt gagtcgctga atatggggac agacagtcct      2280
     ctagggtttg acttggacgc tttagaccct gcattgggct tggaaatccc gagcttacta      2340
     tttttcccgg gcatcatgaa tacattgagc acagacgtaa gcaaccaatg ctacaactga      2400
//

If you have problems or comments...

PBIL Back to PBIL home page