(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE100

ASFUM1_6.PE100       Location/Qualifiers
FT   CDS_pept        join(complement(368500..368573),complement(368322..368440),
FT                   complement(367220..368254),complement(366678..367027))
FT                   /codon_start=1
FT                   /gene_family="HOG000202441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263238"
FT                   /orf_name="AFUA_6G02130"
FT                   /product="Rab geranylgeranyl transferase escort protein,
FT                   putative"
FT                   /function="transferase activity"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="EAL85826.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG056357"
FT                   /db_xref="HOGENOM:HBG327029"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI000051F411"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR2"
FT                   /transl_table=1
FT                   /translation="MESLAETPWDVTISGTGLAQSLLALALSRSGKKVLHIDRNPYYGG
FT                   SEAAFSLQEAENWVSQVNQEPKSFPFEDASILKPQQTEECNARLASSRAYTLTLSPQLI
FT                   YCRSTLLPTLVSSKVYRQLEFQVVGSWWIYRPSSNSASGSSSTTVNAFSDLYRVPSSRE
FT                   DVFADDVISVKSKRTLMRFLRRIANPQQNDECSSEQEDLTGSFPDYLNSSFHVPAELHD
FT                   PLLSLSLAQSPPTQTSAEYAVTRIKRHLTSIGVFGPGFGSLVAKWGGGSEISQVACRAL
FT                   AVGGGVYVLDSGIQSVRNDPIEADNGDVGRIEAQLANDESIKTRFLVGSNWDLPANVLE
FT                   SAHYEKVSRSITVVSSSLESLFPVTAEGGPIPVCAVVVFPGALLGQRDDSPSVYILVHS
FT                   SETGECPPGQSVLYSSISISGPDGQSLLESAVQKLLQSSADPNAKILWCLRFTQLGRPS
FT                   RDVRGTPGIQRSSLSANILSFPPPSLDLAFDDGVIDTVKEAWKIIMGDQASDDFMNFED
FT                   REGAYDAE"
     atggagtcgt tggcagagac gccatgggat gtaacaatct ctggtacagg gctggcgcag        60
     tcacttctgg cattggccct ctcgcggtca ggcaagaagg tacttcacat tgaccgtaat       120
     ccatattatg gaggttctga ggcagcattc agccttcagg aagctgagaa ctgggtttcc       180
     caagtgaatc aagaaccgaa gtctttcccc tttgaagacg cgtccatttt gaagccccag       240
     caaacagagg agtgcaacgc tcgactagct tcttctcgag catacacact tacgttgtca       300
     ccgcaactga tctactgccg ttctacattg ttgcccacgc tagtgtcctc gaaggtctac       360
     cgccagcttg aatttcaggt cgttggaagc tggtggattt acagaccttc gagcaactcg       420
     gcttccggga gcagtagcac gactgtcaat gcattctcag atttgtaccg tgtgccgagc       480
     agccgcgaag atgttttcgc cgatgatgtg attagcgtta aatcaaagcg aacgctgatg       540
     aggtttctcc gacgcatcgc caatcctcaa caaaatgatg aatgctcgtc ggaacaggag       600
     gatctgaccg gttcattccc agactatctc aactccagtt tccatgtccc tgccgaactt       660
     cacgatcccc ttctatcgct ttcattggcc cagagtcctc cgacccagac atcagccgaa       720
     tatgcggtaa cgcgcatcaa gcggcacttg acctctatag gtgtcttcgg tcctggattt       780
     ggaagtttgg ttgccaaatg gggtggagga tccgagatct ctcaagtggc ctgccgagct       840
     ctcgctgtcg ggggcggagt gtacgtcttg gattctggga tccagtcggt cagaaatgac       900
     cccattgagg ccgacaatgg cgatgttggg cgcatcgagg ctcaacttgc caatgatgag       960
     tcgattaaaa ctcgatttct agttggttca aactgggacc tccctgcaaa tgtcctggaa      1020
     tctgctcatt atgaaaaggt ttcgcggtca atcacggttg tctcttcgtc actagaaagt      1080
     ctctttccgg ttactgcaga aggtggccca attcctgtat gcgcagttgt ggtattccca      1140
     ggagcacttt tgggtcaaag agatgactca ccctcagtat atattctggt tcactccagc      1200
     gagactggcg agtgtccacc aggacaaagt gtcttgtact ctagtatctc catatccgga      1260
     cctgatggtc aatcgcttct tgaaagtgca gtacaaaaac tccttcagtc cagtgcagat      1320
     cccaatgcaa agatcttgtg gtgtttgcgt tttacacagt tggggcgccc tagccgggat      1380
     gtccgtggta cccctggaat tcaaagaagc tcactgtcgg cgaatatact ctccttcccg      1440
     cctcccagcc ttgatcttgc ctttgacgat ggggtcattg acacggtgaa ggaagcgtgg      1500
     aagataatca tgggcgatca agcttcagat gactttatga atttcgagga ccgcgaaggt      1560
     gcttacgatg ctgaatga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page