(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE102

ASFUM1_6.PE102       Location/Qualifiers
FT   CDS_pept        join(370513..371048,371229..371582,371755..371809)
FT                   /codon_start=1
FT                   /gene_family="HOG000048650" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207411"
FT                   /orf_name="AFUA_6G02150"
FT                   /product="Signal peptide peptidase, putative "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85824.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056356"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniParc:UPI000051FFE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR4"
FT                   /transl_table=1
FT                   /translation="MDEVSPLAELLGQAIYQYTKIKPFLPTYGHLLVSALFPIYIGAHA
FT                   SLSRPSSAAKPPKKDTNNIETDNEEEDEEGLSPVQKMEGLEPSDALMFPLTAGLTLGGL
FT                   YLIIKWLDDPAILNKVLSFYFSQMGLFFAVAFLKDCLLVFRSFLFPRRYRFAGRIWRAK
FT                   QSERVFKADQQDSTQGALLALSTVGYFAFVAKPWWLTNFLGFSFCYGALQFMSPSTFKT
FT                   GSLILGSLFLYDIYFVFYTPLMVTVATKLDVPIKLLFPRPPAPGEAPDVVSLAMLGLGD
FT                   IVIPGMMVGLALRFDLPFPNLISRPACLGTLSE"
     atggacgagg ttagtccact tgcggagctc ttggggcagg ccatctacca gtacacgaag        60
     atcaaacctt tcctaccgac atacggccat ctacttgttt cggctctctt tcctatttac       120
     attggcgccc atgcatccct ttcgagaccc tcgtctgctg ccaaacctcc caagaaagac       180
     acgaataaca tcgaaacaga caatgaggaa gaagacgagg aaggactgag ccccgtccag       240
     aagatggagg gtcttgagcc cagtgatgcg ctaatgttcc cgttgactgc cggtctcact       300
     ctcggtggtc tctatttgat catcaaatgg ttggatgatc cagccatatt gaacaaggtc       360
     ctgagctttt acttttctca gatgggactc tttttcgcag tcgcattcct gaaggactgt       420
     cttttggtct ttcgatcctt tcttttccct cgccgatatc gattcgctgg caggatttgg       480
     agggcgaaac agtcggaacg agtttttaaa gccgatcagc aggactcgac gcagggtgcg       540
     ctgctagctc tgtctactgt tgggtatttc gcatttgttg cgaaaccatg gtggctgaca       600
     aactttctgg gtttcagctt ctgttacggc gcgctgcagt tcatgtcacc atcaacgttc       660
     aaaactgggt cacttattct gggctcgttg tttctctatg atatctactt tgttttttat       720
     accccgttaa tggtgacagt cgctacaaaa ctagatgtac caatcaagct tttgtttccc       780
     cggccacctg ctcctggtga agccccggat gttgtttcct tggcgatgct gggcctgggg       840
     gacattgtca ttcccggtat gatggtggga ctggcgctcc gatttgatct tcctttccca       900
     aaccttattt caaggccagc ttgtttgggt acattgtcgg aatga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page