(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE107

ASFUM1_6.PE107       Location/Qualifiers
FT   CDS_pept        384019..385632
FT                   /codon_start=1
FT                   /gene_family="HOG000202382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263241"
FT                   /orf_name="AFUA_6G02200"
FT                   /product="C2HC5 finger protein"
FT                   /function="transcription regulator activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85819.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG056350"
FT                   /db_xref="HOGENOM:HBG327026"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="UniParc:UPI000051EA71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR9"
FT                   /transl_table=1
FT                   /translation="MSNSNLVAWAVPRLAQLLPLDEESLTQIITYSAGLPKEEGAEHLK
FT                   NLLGDSPAAFEFIASFSARRDQTQAQTRSTVPSPVRGGEEQSAATDAYTTDNVNSGTKA
FT                   GAKRGKKAKAPLHSAGPVRRPENFGNVAGGYRKEDQDEEYMSAGTARQVRQDTAALRSK
FT                   GSASSLQVPQRQSALSSLESSAASSRTQSPAPRSSGTPKNPPSASGPVLSDLLPNVKSK
FT                   AAKPSTRQQGGGSSSKGALTTNNISDLTAAIAALEVSTNPTLGNGRQKCNCYATIHPLF
FT                   EPAPNCLNCGKIICSLEGLQPCSFCGTPLLSNEEVQSMIRELRAERGQERMRAHNESVH
FT                   REGGPGPTPVGNSKLDAAKAHRDKLLQFQAQNAKRTRVVDEAADFETPNVASTLWMSPA
FT                   QRALALKKQQRILREMEEQARPEWEKKKTVMSLDIKGGRVTRVYQSAAPAQSSSAAEEK
FT                   EEDVEDVSYEKSKPTGGEAFSRNPLLAAGGLLRPVWKAADDKQERTATKERKQTWRRVQ
FT                   DDNDDNEQWILDGGLHGYTT"
     atgagtaact caaacctcgt cgcgtgggca gttcctcgcc tggcccagct cttgccactg        60
     gacgaggagt ccctgacaca gattatcact tactctgccg gtcttccaaa ggaagaaggt       120
     gccgagcatc tcaaaaatct cctcggcgac tcgcccgccg ccttcgaatt catcgcctcc       180
     ttcagcgccc gccgagacca aacccaagcc caaacccgat ccaccgtccc atcgccagtt       240
     cgaggcggag aagagcaatc cgcagcgacc gatgcataca ccactgacaa tgtgaattct       300
     gggacaaagg ccggagccaa aaggggcaaa aaggccaaag cgcctcttca cagcgcgggg       360
     cctgtacgcc ggcctgagaa tttcgggaat gtggcgggag gctacaggaa agaggatcag       420
     gatgaggagt atatgtcggc tggaacggct cggcaggtga ggcaggatac agctgcttta       480
     cgatcaaagg gttcagcttc ttcgctgcag gttccgcagc ggcaaagcgc tttgtcttcg       540
     cttgaatcgt ccgccgcgtc gtcacgtacg caatcccccg cgccgaggtc gtcgggtacc       600
     cctaagaacc cgccgtccgc atcgggacca gtgctctcag acctcctgcc caacgtcaag       660
     tcgaaagctg ccaagccatc tacccgacaa cagggaggcg gaagctcatc taaaggagcg       720
     cttacaacaa acaacatctc cgacctgacg gccgcgattg cggccctcga agtctctacg       780
     aatccgacgc taggaaatgg caggcaaaaa tgcaactgct acgctacaat ccatccgctc       840
     ttcgaaccgg ctccaaactg cctgaactgc ggcaagatca tctgctccct tgaaggtctc       900
     cagccatgct cgttctgcgg gacgccgctc ctatcaaacg aagaagtgca gagtatgatc       960
     cgggagctgc gcgcggagcg tggacaggag aggatgcggg cgcataatga aagtgtccat      1020
     cgggagggtg ggcccgggcc gactcccgtg ggaaacagca agcttgacgc ggccaaggcg      1080
     caccgtgata agttacttca gttccaggcg cagaacgcca aacgcacgcg ggtcgtcgac      1140
     gaggctgccg atttcgaaac gccgaatgtg gcgtcgacgt tgtggatgag cccggcccag      1200
     cgggcgttgg cactaaagaa acagcagcgg atactccgag agatggagga acaggcgcgg      1260
     ccagagtggg agaagaagaa gactgtcatg agtttggata tcaaaggagg ccgcgtgacc      1320
     cgcgtgtatc aatctgccgc gcctgcgcag tcgagctcgg ccgcggagga gaaagaggag      1380
     gacgtcgagg atgtgtcata tgaaaagtcg aaaccaactg gcggtgaagc tttcagtcgg      1440
     aacccattac tcgcagctgg cggcctgcta cgacccgttt ggaaggctgc ggacgacaag      1500
     caagaaagga cagctacaaa agaacgcaag cagacatggc ggcgtgtcca agacgacaat      1560
     gatgacaatg aacaatggat tctcgatggt ggtttgcacg gctataccac ttag            1614
//

If you have problems or comments...

PBIL Back to PBIL home page