(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE109

ASFUM1_6.PE109       Location/Qualifiers
FT   CDS_pept        join(388721..388816,388877..389428)
FT                   /codon_start=1
FT                   /gene_family="HOG000201616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263242"
FT                   /orf_name="AFUA_6G02215"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27246.1"
FT                   /db_xref="UniParc:UPI0000F51CD7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA28"
FT                   /transl_table=1
FT                   /translation="MPSPLTTTLIQSTLLNALSNILAQIIAQHKKDGPFTLNTLALLQF
FT                   LTYAIIIVPINFSWQKYLEARWPGFPGRKGRSTPTAVAGAEAKTGAVVVTVESADLLPV
FT                   KEKVEEKQRVSAARPRPRSRWRWRSRSRLRSRSGLGNFLMKFVLDQTVGSVMNILLFIV
FT                   LINVLKGVGWSRIGELIYEVRLVHFVIGPFHGEKMVIEVMRVGLWADHGCAA"
     atgccctccc ccctaacaac gaccctaatc caatccaccc tcctcaacgc cctctccaac        60
     atcctcgccc aaatcatcgc ccagcataaa aaagacggcc cgttcacact caacaccctg       120
     gccctcctcc agttcctcac ctacgccatt atcatcgtcc ccattaactt ctcctggcag       180
     aagtatctgg aggcgagatg gccagggttt cctgggagga agggcaggag tacgcctact       240
     gctgttgctg gcgccgaggc gaagactggc gctgtggtgg tgacggttga gtcggcggat       300
     ctgctccctg ttaaggagaa ggtggaggag aagcagcggg tatctgcagc acgaccacga       360
     ccacgatcac gatggcgctg gcgctcgcgg tcgcggttgc ggtcgcgctc cggactgggc       420
     aatttcctaa tgaagttcgt cctcgatcag acggttgggt cggtgatgaa catcctcttg       480
     tttattgttt tgattaatgt gctcaagggg gtggggtgga gcaggattgg agagttgatc       540
     tatgaggtac gcttggtcca tttcgttata ggtccttttc atggagaaaa aatggtgatt       600
     gaagtaatga gggtaggact ttgggccgat catggttgcg cggcttaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page