(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE113

ASFUM1_6.PE113       Location/Qualifiers
FT   CDS_pept        join(403252..403521,403623..404132)
FT                   /codon_start=1
FT                   /gene_family="HOG000202371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750826"
FT                   /orf_name="AFUA_6G02260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85813.1"
FT                   /db_xref="HOGENOM:HBG056346"
FT                   /db_xref="HOGENOM:HBG738556"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniParc:UPI000051FFE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS5"
FT                   /transl_table=1
FT                   /translation="MHYNTSLTPIAALLDFIVPGITTTLSLSQYSKGPLPSGQSPRNKS
FT                   KLQQKALRPNQPSKYKSNPLTSQSNSNAPIQFSSNLVDALQTNTETDSSRAKSLELQIQ
FT                   ARVAQELERLREREQQTLAEIEKRLAEAKDSAPAAPSSTPNITYPAGSLNLDAPRIPFA
FT                   GREYESTPAPTVAADQPINRDLSRESVNAEIEQLRAKLEGRRKLVEVDENVERARNEVV
FT                   TCLRLHDRRPLDCWKEVEGFKREVARLEEAFVDRVVG"
     atgcactaca atacgtctct gaccccaatt gctgcgctgt tggactttat tgtgcctggc        60
     atcaccacga cgctgtcgtt gagtcaatac tcgaagggcc cgttgccgag cgggcaaagt       120
     cctcgcaata aaagcaagct gcagcagaaa gccctacggc cgaaccagcc atccaaatat       180
     aagagcaatc cgctgacttc tcaatccaac agcaacgccc ccatccaatt ctcctctaac       240
     ctcgtcgatg ccctccagac gaacaccgag accgactcct cccgcgccaa gagcctggag       300
     ctccagatcc aagcccgcgt agcccaggaa ctcgagcgcc tccgcgaacg cgagcagcag       360
     accctcgccg aaatcgaaaa gcgcctggca gaagccaaag acagcgcccc ggccgccccc       420
     tcatcaacgc caaacattac ctacccagcg ggctcgctga acctagacgc gccgcgcatc       480
     cccttcgcgg gccgcgagta cgagtctacc cctgcaccca ctgtcgccgc cgaccagccc       540
     atcaaccgtg atcttagccg ggagtcggtg aatgcggaga ttgagcagct gcgcgctaag       600
     cttgagggac ggcggaagct cgtcgaggtg gatgagaatg ttgagcgggc gcggaacgag       660
     gttgtgacct gtttgcggtt gcacgataga cggcccttgg attgttggaa ggaggttgag       720
     ggcttcaaga gggaggttgc caggcttgag gaggcgtttg tggaccgtgt tgtcggttga       780
//

If you have problems or comments...

PBIL Back to PBIL home page