(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE115

ASFUM1_6.PE115       Location/Qualifiers
FT   CDS_pept        join(complement(408429..408478),complement(408055..408331),
FT                   complement(407836..407979),complement(407732..407767))
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI16263245"
FT                   /gene_name="pmp20"
FT                   /orf_name="AFUA_6G02280"
FT                   /product="Putative peroxiredoxin pmp20 "
FT                   /EC_number="1.11.1.15"
FT                   /function="peroxidase activity"
FT                   /function="peroxiredoxin activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="EAL85811.1"
FT                   /db_xref="EMBL:AAB95638.1"
FT                   /db_xref="GO:0004601"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0051920"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI0000131C89"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43099"
FT                   /transl_table=1
FT                   /translation="MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWAD
FT                   KKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQV
FT                   TGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAET
FT                   VLKHL"
     atgtctggac tcaaggccgg tgacagcttc ccctctgacg ttgtcttctc ttacatcccc        60
     tggtccgagg acaagggtga gatcactgct tgcggtatcc ccatcaacta caacgcctcc       120
     aaggagtggg ccgacaagaa ggtcattctc ttcgctcttc ccggtgcctt cactcccgtc       180
     tgctctgctc gccacgttcc cgagtacatc gagaagctcc ccgagatccg tgccaagggt       240
     gttgacgttg ttgccgtcct cgcctacaac gatgcctatg tcatgagcgc ctggggcaag       300
     gccaaccagg tcactgggga cgacattctc ttcctctccg accccgatgc tcgcttctcc       360
     aagagcattg gttgggccga tgaggagggc cgcaccaagc gttacgccct cgtcattgac       420
     cacggcaaga ttacctacgc cgctctcgag cccgctaaga accacctcga gttctcgagc       480
     gccgagaccg tcctcaagca cctgtaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page