(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE116

ASFUM1_6.PE116       Location/Qualifiers
FT   CDS_pept        complement(410772..411101)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263246"
FT                   /orf_name="AFUA_6G02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85810.1"
FT                   /db_xref="HOGENOM:HBG056343"
FT                   /db_xref="UniParc:UPI000051F412"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCS8"
FT                   /transl_table=1
FT                   /translation="MLFADVYSINVNPINKPAAVTVPVRSKYHVIPAHHSLAHLASFPF
FT                   KRPILEAVAALPAHPIFCVLILVPELHGNTVICESKKLLAESVIMFTLPFAGQERDNRF
FT                   CAREE"
     atgctcttcg ctgatgtcta cagcatcaac gtcaacccca tcaacaaacc agcggccgtc        60
     accgttcccg tccggtccaa gtaccacgtc attcccgctc atcattctct tgcgcatctt       120
     gccagtttcc cgttcaaacg tccaatcctc gaggccgtag cagcgcttcc agcgcatccc       180
     atcttctgcg tcctgatact cgtaccagaa ctgcacggca atacggtcat ctgtgaaagc       240
     aaaaagctcc ttgcggagtc ggtaattatg ttcacgcttc catttgcggg tcaggaacgt       300
     gacaatcgct tctgtgccag agaagaatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page