(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE121

ASFUM1_6.PE121       Location/Qualifiers
FT   CDS_pept        join(complement(440400..440939),complement(439897..440313),
FT                   complement(439764..439826),complement(439374..439682),
FT                   complement(438741..439286))
FT                   /codon_start=1
FT                   /gene_family="HOG000202305" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902853"
FT                   /orf_name="AFUA_6G02360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85803.1"
FT                   /db_xref="HOGENOM:HBG056337"
FT                   /db_xref="HOGENOM:HBG327009"
FT                   /db_xref="UniParc:UPI000051FFDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT5"
FT                   /transl_table=1
FT                   /translation="MEGKETNGQASGHESGYAFTSPYPQSYNMLPFGAPGMPGFAPRQG
FT                   QYMMAPGNPNPSQPLQRGGPFMYSPFYGMQSMAHALPGVIGQAHGMHSPMPASNTKLQL
FT                   SVRPKQTGFTPTGSHWAPRSSLHQLLEHDSASRDIATQAVDCEKSFDTVALPAEMPIGS
FT                   QVHNRMPSQWGVVKIANIPYSVTRQEIIQFLGRQARLITPQQGCAIHIIMERSTAKTMD
FT                   CYAEFQSANDAQETATRINRIYETGRAPRLGNRSVDVEFSNQDALLKDLFPRAKCIIWK
FT                   DAMPTAVPNDDPFSTGFSGFFTSEEIVNAIRHAEIPHRSPFCAKCPQRTYESTISTLYK
FT                   FPWYATKLYTVHDRNQLFELVSRHILSLVARVKRSNTVGLDQRLLRELLYAGLNCPAFN
FT                   ERQKYTLCVNSEDTTEILKFPDMGKWFPFDTLVKLPKSEESTLLYYVKLISKGTLHDRT
FT                   DMKLPNNFPLTNIHLESPYGPIWFEWPSNIAKTMTWEDASLHEMSILSHLVLTGWMKND
FT                   QENTKKSGLLPDSTTGSSRESHANTIVSSGSDNSPIDVRTPSRTDNLATPSRRASVQLG
FT                   SRSSFAESSDDSWRRAIYMHSSAGMRGRFPGHRNTQSSPTCLPSAGNP"
     atggagggca aggagacgaa cggtcaagcc tctggacatg agtccggata cgctttcaca        60
     tctccttacc cacagagcta caacatgctt ccgttcggag ctcctggcat gccgggcttt       120
     gctccgcggc agggacagta tatgatggcc ccaggcaatc cgaacccgtc ccagccattg       180
     cagcggggag gccccttcat gtactctcct ttctatggta tgcagagtat ggctcacgct       240
     cttcctggcg tcataggaca agcccacggg atgcattctc cgatgcctgc ctcgaacact       300
     aagctccagc tttcagtccg tcccaagcag acagggttca ccccaactgg ctctcactgg       360
     gctccgcgct cttctttgca ccagctcctg gagcatgact ctgcgagtcg tgatatagct       420
     acccaggcag ttgactgtga gaagagtttc gacacggtgg cccttcccgc cgagatgccg       480
     attgggagcc aagtccacaa cagaatgccc tctcaatggg gagtggtaaa gatcgcgaat       540
     attccctact cagtcacccg gcaggaaatc attcagtttc taggtcgtca ggcacgcctt       600
     attactccgc aacagggctg cgcaatccac atcataatgg aacgttccac cgctaagaca       660
     atggactgct atgcggagtt ccagtccgcg aatgatgctc aggagacagc tactcgcatt       720
     aaccgaattt atgagactgg tcgcgcgcct cgtctgggta atcgctctgt tgatgttgaa       780
     ttcagtaacc aagacgctct gctcaaggac ctgttccctc gtgccaagtg catcatctgg       840
     aaagatgcta tgccaaccgc cgtccccaat gatgacccct tttctactgg gttctcgggc       900
     tttttcacca gcgaggaaat cgtcaatgcc attcgccatg cagagatacc tcaccgttct       960
     ccattttgtg cgaagtgtcc tcagcgcacc tacgagtcca ccatcagcac actctacaag      1020
     ttcccgtggt acgctaccaa gctgtacact gttcatgacc gcaatcagtt gtttgagctg      1080
     gttagtcggc acatcctgtc tctcgtcgcg cgagtcaaga ggtcgaacac agttggtctc      1140
     gaccaaagac tgctgagaga acttctttat gctggattga attgtcctgc cttcaacgag      1200
     cgccagaagt acaccctgtg tgtcaattcg gaggatacca cagagatctt aaagttccca      1260
     gatatgggca aatggttccc tttcgatact cttgtcaagt tgccaaagag cgaagagagt      1320
     acactgctgt attatgtcaa gctgatatcg aaaggcaccc tccatgatcg tactgatatg      1380
     aagctgccaa acaacttccc tttgacgaac attcaccttg agtctcctta cggtcccatc      1440
     tggttcgaat ggccatcgaa catagctaag accatgacct gggaagatgc ttccttgcat      1500
     gagatgagca tccttagcca tcttgtcctg acgggctgga tgaagaacga ccaggagaac      1560
     acaaagaaat ccggcctact gcccgattct actaccggaa gcagtcgcga gtcccatgcc      1620
     aataccatcg tatcatctgg gagcgataat agtccaatcg atgttcggac accttccagg      1680
     accgataatc tcgcgacacc ttcccgccgt gcaagtgttc aacttggcag ccgcagctcc      1740
     ttcgcagaga gcagtgatga cagctggcgc cgtgcaattt atatgcattc ttcggctggc      1800
     atgcgaggta ggtttcctgg tcatcggaat acccagtcgt ctcccacttg tcttccgtcc      1860
     gcaggcaacc cttaa                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page