(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE122

ASFUM1_6.PE122       Location/Qualifiers
FT   CDS_pept        join(complement(442663..442665),complement(442284..442610),
FT                   complement(442109..442234),complement(442007..442051),
FT                   complement(441939..441947))
FT                   /codon_start=1
FT                   /gene_family="HOG000202303" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750828"
FT                   /orf_name="AFUA_6G02370"
FT                   /product="ARP2/3 complex 20 kDa subunit (P20-ARC), putative"
FT                   /biological_process="actin filament polymerization "
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL85802.1"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030041"
FT                   /db_xref="HOGENOM:HBG026656"
FT                   /db_xref="HOGENOM:HBG314395"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="UniParc:UPI000051E834"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT6"
FT                   /transl_table=1
FT                   /translation="MSQSLRPYLQCVRSSLTAALAISNFASQTSERHNVPEIEAQSSPE
FT                   LLLNPLTISRNENEKVLIEPSVNSVRVSIRIKQADEIEHILVHKFTRFLTQRAESFFIL
FT                   RRKPVKGYDISFLITNFHTEAMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFVAES
FT                   FLTPFD"
     atgtctcaat cactgcgccc gtaccttcaa tgcgttcggt cctcgcttac cgctgctctt        60
     gcaatctcga acttcgcctc gcaaacctcc gaaaggcata atgtccctga aatcgaggct       120
     cagagctccc cagaactgct cctcaacccc ctcacaattt ctcggaatga gaatgaaaag       180
     gtcttgattg agcccagcgt aaacagtgtg cgcgtcagca tcagaattaa gcaagcagat       240
     gaaattgagc acatcctggt ccacaagttt accagattct tgacgcaacg agcagaatcc       300
     ttcttcatct tgcggaggaa accagtcaag ggatacgaca tctcgttctt gatcacgaac       360
     ttccatacag aagctatgtt gaagcacaag ctggtcgact tcatcattca attcatggag       420
     gaagtagata aggaaatatc tgagatgaag ctcttcttga atgcccgtgc tcgatttgtc       480
     gccgagtcgt tcttgacacc atttgactaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page