(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE123

ASFUM1_6.PE123       Location/Qualifiers
FT   CDS_pept        join(443140..444793,444856..444917)
FT                   /codon_start=1
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207414"
FT                   /orf_name="AFUA_6G02380"
FT                   /product="Ubiquitin C-terminal hydrolase, putative "
FT                   /EC_number="3.1.2.15"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="EAL85801.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="HOGENOM:HBG524155"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000051E826"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT7"
FT                   /transl_table=1
FT                   /translation="MFSVIVKHQGKRHEVELDPSANGETLKYQMYSLTGVEPERQKILV
FT                   KGGQLKDETPLSALNAKPGQTFMMMGTPSGGQDAVDLGRPKEPVKFLEDMTEAEAARAE
FT                   GAIPAGLQNLGNTCYLNSTLQTLRSVPELQQELLNYKPSAGSSAGSRLSDLSSLGLGGL
FT                   GASMDLVSSLRDLFKQMSETQEGFPPLMFLNALRSVFPQFAQKDRNGHGYAQQDAEEAW
FT                   SQIVTQLRSKLVIKEGEGDSATEVSFVDKFLAGRFESVTECDDPAAKAAGEEATKSSDI
FT                   FFKLDCHIGKETNHLHDGILAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVR
FT                   FFWKRETQKKAKIMRKVTFPAELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARK
FT                   RQKLAHQREEELKRAAESDAGLEPLQKKKATEGQKEATKSGEQDGDTAMTDVFKSDAEY
FT                   EAEKYASILAAKKELAALIDPKLASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKK
FT                   QPNGKGVEDGKWWWFNDEKVTEVDGEKIETLAGGGESHSALILLYRAVDLPTAE"
     atgttctcag ttatcgtgaa gcatcaaggc aaacgtcatg aagtcgagct cgatccgtct        60
     gcaaatggcg aaacgctgaa atatcaaatg tactccttga ctggagttga acccgagaga       120
     cagaagatct tggtcaaggg tggccagctg aaagatgaga cgcctttgtc cgccctcaac       180
     gctaaaccag gtcagacatt tatgatgatg ggtacaccgt ctggcggcca agatgcggta       240
     gacttgggac ggccaaagga accagtcaag tttcttgagg atatgaccga agccgaggcg       300
     gccagagcgg agggtgccat tcctgctggt ctacagaatc ttggaaatac ttgctacctc       360
     aactctaccc tacaaaccct gaggagcgtc ccggagcttc aacaggagct cctaaattac       420
     aagcccagcg cgggctcttc agcgggttca agactttcag atctcagcag cctgggcctt       480
     ggtggtcttg gtgcctccat ggatcttgta tcctccttgc gcgatttgtt caagcagatg       540
     tccgagacgc aagaagggtt cccaccactt atgtttctca atgctttgag aagcgttttc       600
     cctcaatttg ctcagaaaga caggaatggt catggctatg ctcaacaaga cgctgaagag       660
     gcttggtcgc aaattgtcac tcaactgcga agcaaactgg tgatcaaaga gggcgaagga       720
     gattccgcta ccgaggtgtc gtttgtggat aaatttcttg ctggtcgatt cgaatcggtc       780
     accgaatgtg acgatccggc ggccaaggca gctggcgagg aagcgaccaa aagctccgac       840
     atcttcttca agctggattg ccacatcggc aaagagacaa accatctgca tgatggaata       900
     ctggccggac tcgaggagaa aattgaaaag cgatcaccta cgttggaccg cgacgctgtc       960
     tacactaaac gatcccgcat tgcccggcta cccaagtatc tgactgtgca ctttgtccgc      1020
     tttttctgga agcgtgagac ccaaaagaag gccaagatca tgcgcaaagt gactttccct      1080
     gccgaattgg atgtggtgga gttttgtacg gaggagctca agaagcagtt gatccccatc      1140
     agggataagg tacgagatat tcggaaagaa gaggtcgacg ttgagcgtgc ccgcaagcgc      1200
     cagaagcttg ctcatcaacg ggaggaggag ctgaagagag ccgctgagtc tgatgcgggt      1260
     ctggaacccc tgcaaaagaa gaaagctacg gaggggcaaa aagaggctac aaagagcggc      1320
     gagcaagatg gggacacagc catgacagat gtcttcaagt cagacgcaga gtacgaggcc      1380
     gagaagtatg cctcaatact cgctgcaaag aaggaattgg ctgcactgat tgaccccaaa      1440
     ctcgcctcag atgctggtac aaacaactcg ggcctctacg agttgcgcgc agtcattacg      1500
     catcaaggcg ccagtgctga cagtggacac tacacgtcat atgtgaagaa gcagccaaat      1560
     ggcaaggggg tggaggacgg aaaatggtgg tggttcaacg acgagaaggt caccgaagtg      1620
     gacggagaga agatcgaaac ccttgctggt ggtggcgaat cccattctgc actgatcctt      1680
     ctctaccgcg cagttgactt gcccactgcg gaataa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page