(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE124

ASFUM1_6.PE124       Location/Qualifiers
FT   CDS_pept        join(445384..445812,446001..446378)
FT                   /codon_start=1
FT                   /gene_family="HOG000202271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263249"
FT                   /orf_name="AFUA_6G02390"
FT                   /product="Thioesterase family protein "
FT                   /protein_id="EAL85800.1"
FT                   /db_xref="HOGENOM:HBG056335"
FT                   /db_xref="HOGENOM:HBG327007"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI00005206C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCT8"
FT                   /transl_table=1
FT                   /translation="MLGPRRIFQSRPRCNATQLKSVHLSKPRLSRHTSTIAPAEPPTTK
FT                   SRWPRRLAYAGIFGGLGVAAGKWMDEKVSAPAVPGTVEDAAKLEEINHVFEHGLPIVQE
FT                   LRNNPDYLETNAYEGFSEEDKAHRLTSGPLRGSRGLALQRVFYNDKEKKVICVVYLGSG
FT                   LEGWPTVVHGGVLATVLDENLGRAAIRHFPARTGVTANLEINYRAPVYSGNFYTFHSQV
FT                   DPERSTERKAFVTGEIRDPVGRVCAQASAIFVVPKGFKLRKIGERF"
     atgctcggtc ctcgcagaat ctttcaatct cggccgcgtt gtaatgcaac tcagttgaag        60
     tcagtgcatc tctcgaagcc ccgtctgtcg cgccatacca gcactattgc cccagctgag       120
     ccaccaacaa ccaagtcgag gtggccacgg cgattggcct acgcaggaat atttggtgga       180
     ttaggggtcg ccgctggtaa atggatggat gagaaggtct cggcacccgc tgtgccagga       240
     accgtggaag acgcagccaa gctggaggag atcaatcatg tattcgagca cgggctgcct       300
     atcgtgcaag agctaagaaa caatccggac tacctggaaa cgaatgcata cgaaggattt       360
     tcggaggagg acaaggcgca cagattgacg tctggaccgc tgcgtgggag tcgggggttg       420
     gcgctccaga gagtttttta taatgacaag gagaagaaag tcatctgtgt ggtatacctc       480
     ggatcgggtc tggagggttg gccaacggtt gtccatggtg gcgttctcgc tactgtgctt       540
     gacgagaatc tgggacgtgc tgctatacgc catttcccgg cacgcaccgg cgtgacggcc       600
     aatcttgaga tcaactaccg cgctccggta tattcaggca acttctacac atttcactcg       660
     caggtagacc cagaaagaag cactgagcgc aaggcgttcg tgactggtga aatccgcgac       720
     ccggtcgggc gagtgtgcgc gcaagcctct gcgatttttg tggtcccaaa gggattcaag       780
     ttgcggaaga ttggagaacg attctaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page