(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE127

ASFUM1_6.PE127       Location/Qualifiers
FT   CDS_pept        join(455227..455279,455344..455432,455491..455622,
FT                   455674..455849)
FT                   /codon_start=1
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263251"
FT                   /orf_name="AFUA_6G02420"
FT                   /product="Ubiquitin conjugating enzyme (UbcM), putative "
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="EAL85797.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000051FB5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU1"
FT                   /transl_table=1
FT                   /translation="MALPKRIVKETERLMAEPVPGINAVPHEDNLRYFDVSIHGPAQSP
FT                   YEGGIFRLELFLPEDYPMTPPKIRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTIL
FT                   LSIQALLGAPNPDDPLANDVAQRWKEDEQAAIQTAKEWTRTHAMT"
     atggcccttc caaagcgaat tgtgaaggag accgagcgcc ttatggcaga gccggtcccc        60
     ggtatcaatg ctgtgcctca tgaagacaac cttcgatact ttgacgtgtc gatccatgga       120
     cctgctcagt cgccgtacga aggtggcatt ttccgtctag agctctttct gccggaggat       180
     tatcctatga ccccgccaaa gatccgtttc ttgaccaaga tctaccatcc caacattgac       240
     cgccttgggc gcatttgctt ggatgttttg aagaacaatt ggtcccctgc tctgcagatc       300
     cgcacgattc tcctctcaat ccaggccttg cttggagctc ctaaccccga tgacccgctc       360
     gccaatgatg ttgcacagcg ttggaaggag gatgagcaag ctgcgataca aactgcgaag       420
     gaatggacga gaactcatgc aatgacttag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page