(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE128

ASFUM1_6.PE128       Location/Qualifiers
FT   CDS_pept        join(456861..457671,457734..457865,457905..457951,
FT                   458016..458399,458475..458522)
FT                   /codon_start=1
FT                   /gene_family="HOG000217791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207416"
FT                   /orf_name="AFUA_6G02430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85796.2"
FT                   /db_xref="HOGENOM:HBG056332"
FT                   /db_xref="UniParc:UPI0000F51CD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU2"
FT                   /transl_table=1
FT                   /translation="MSPDPHAADRKAQKQREKKMNAERLKYQKQQSEYFPLTDSFIVPK
FT                   SRVARALDTCVRYLQTTYCVVSFPTHHFVVSGIKNSGKQLKLRSRSFESESRFSSCDVT
FT                   HPASDLPTVPNLKDLPEKVRKRPERSSQVVNKASISLSLLCCPRNCGSVKLTVKQKDPA
FT                   RTSPKESSFTRKFSRTMTGDSVKKVSSMDRKSWQTQSSSAGSGGKTRSIRSASVTATGT
FT                   DLGEGDAATRLEGGLKKLTISEGLKREGKPAAISTAQPKVIKCLRSPGDYVFIDIETPG
FT                   EKSNANSNSSPGISPKAKSAEVGSGEDESGEHEAEAANDQDPRSIVEKRLEVIRHIVKN
FT                   IFQGQSDEDTKTGKALQNAKKWDTKNTKCIKCFGDCPVCSKACCIFDVARRTAAQADST
FT                   PEHAEAANQILKLIQRLGNSVLEATTYSLCTTPGGCGRYVCSDCWGICPVELCHDVQCK
FT                   DCKEDPWAACDWHDY"
     atgagtccgg accctcacgc tgctgatcgc aaagctcaga agcagcgtga aaaaaagatg        60
     aacgccgaga gactaaaata ccaaaaacaa caaagcgaat atttccctct cactgacagt       120
     ttcatcgtcc ccaagagtcg tgttgctcgc gctttggata cttgtgtcag gtatttgcag       180
     acaacatact gtgttgtatc ttttccgact catcattttg ttgttagcgg tatcaagaac       240
     tcagggaagc agctcaaact taggtctcgc tccttcgagt ctgagagcag attctcgtct       300
     tgcgacgtta cgcatcccgc atctgatctc cccacagtgc caaacctgaa ggatctgcct       360
     gagaaggtga gaaagagacc agagaggtca tcgcaggtag taaacaaggc aagtatttcg       420
     ctgtctctgc tctgttgccc aagaaactgc gggtcagtaa aactgactgt caaacagaag       480
     gatcctgcta ggacatcgcc aaaggaaagt tccttcacaa ggaagtttag cagaacgatg       540
     actggtgact ctgtcaagaa ggtcagcagc atggacagaa agagctggca gactcagtcc       600
     tcctccgcgg gcagtggagg caagactcgc tctatccgct ctgcttcggt cacggcgact       660
     ggtacagatt tgggtgaagg agatgccgca acgcgtcttg aaggaggcct caagaagctc       720
     acgatttccg agggcctgaa gagagaggga aagcctgctg ctatctctac tgcgcagcca       780
     aaagtcatca agtgcctcag atcccctgga gactatgtgt tcattgatat cgaaacccca       840
     ggagagaaga gcaacgcgaa cagcaactcc agccctggta tctcccctaa ggccaagagt       900
     gccgaagtcg gctctggtga ggacgaatcc ggtgagcacg aagccgaagc cgcgaacgac       960
     caggacccga gaagcattgt cgagaagaga cttgaagtaa tccgccacat cgtgaagaac      1020
     atattccagg gacagtcaga cgaggatacc aagactggaa aggctctgca gaatgccaaa      1080
     aaatgggaca caaagaacac aaagtgcatc aagtgcttcg gagactgccc agtttgcagc      1140
     aaagcatgct gcatcttcga cgttgctcgc cgcactgctg cccaggcaga ctccacccct      1200
     gaacatgccg aagccgcaaa ccagattctt aagttgatcc agcgcctggg caacagcgtc      1260
     ttggaggcga ccacttactc cctgtgcacc acacccggag gctgcggacg gtatgtctgc      1320
     tccgactgct ggggtatctg tccggtcgag ctatgccacg atgtccagtg caaggactgc      1380
     aaggaagatc cctgggctgc gtgcgactgg catgattact ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page