(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE129

ASFUM1_6.PE129       Location/Qualifiers
FT   CDS_pept        join(459025..459075,459220..459363,459570..459857)
FT                   /codon_start=1
FT                   /gene_family="HOG000184343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207417"
FT                   /orf_name="AFUA_6G02440"
FT                   /product="60S ribosomal protein L24a "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85795.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="UniParc:UPI0000520222"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU3"
FT                   /transl_table=1
FT                   /translation="MRTYDDSFSGQKIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRKN
FT                   PRRIAWTVLYRRQHKKGISEEVAKKRTRRVVKHQRAIVGASLDVIKERRSMRPEARAAA
FT                   RQQAIKEAKEKKAASESRKKAEKAKNAATAAKGTAQRIQSKQGAKGSAPKVAAKSR"
     atgcgtacct acgacgattc tttcagcggt cagaagatct accctggaaa gggtaagctg        60
     tacgtccgtg gcgacagcaa gatcttccgc ttccagaatg gaaagtccga gtccctgttc       120
     ctccagcgca agaaccctcg ccggatagcc tggactgtcc tctaccgccg tcagcacaag       180
     aagggtatct ctgaagaagt tgccaagaag cgcacccgcc gtgtcgtcaa gcaccagcgt       240
     gccatcgtcg gtgcctccct tgatgtgatc aaggagcgcc gcagcatgcg ccctgaggct       300
     cgtgccgccg cccgccagca ggctatcaag gaggccaagg agaagaaggc cgcttccgag       360
     agccgcaaga aggctgagaa ggccaagaac gccgccaccg ccgccaaggg cactgctcag       420
     cgcatccaga gcaagcaggg tgctaagggt tctgctccca aggtcgccgc caagtctcgt       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page