(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE13

ASFUM1_6.PE13        Location/Qualifiers
FT   CDS_pept        join(70944..70973,71030..71440,71494..71946)
FT                   /codon_start=1
FT                   /gene_family="HOG000158905" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902573"
FT                   /orf_name="AFUA_6G00230"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84242.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG050941"
FT                   /db_xref="HOGENOM:HBG329511"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EB22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X7"
FT                   /transl_table=1
FT                   /translation="MAYKNVVLVGAGNIGRIILRGLEDSSQFNITVLSRKESSAVFPDS
FT                   VNVWKTDYSKSDLEAAFTGQDVVISALGALGFTEQRKLVDAAVQSGVKRFLPSEFSCNS
FT                   QNGTVIELLPLFQQKADIIQYLKSKESTGLTWTSLVTSLLFDWGLENGFLGYDISSRTA
FT                   TIWDDGNKKFTLTNEGHLSKAVVSVLQRPNETKNQILYIASVETSQNEILNAFETVTGC
FT                   KWSIIRTTTEEQVTEARMKLSKGDFDGALTLVRATSYSNLPGLKSNYAKGFKVANDILG
FT                   LEWANVEDTVRTVVSK"
     atggcttata agaacgtcgt cctagtaggg gctggcaaca ttggcaggat tatccttcgt        60
     ggccttgagg actcgtcaca attcaacatt accgttcttt cccgcaaaga aagctcagcg       120
     gtctttccag actctgttaa cgtatggaag accgactatt cgaagagcga tcttgaagca       180
     gctttcactg gacaggatgt tgttatttcg gctctgggtg cacttggatt tacagagcag       240
     cggaaactcg tggacgctgc tgtccagtca ggtgtcaagc gattcctgcc ttcggaattt       300
     tcatgcaaca gccagaacgg cacggtcatc gaattattgc ccttatttca gcaaaaagcc       360
     gatatcatac aatatctcaa gtccaaagaa tctactggac tgacttggac cagtctggtt       420
     acgtctctgt tgttcgactg gggccttgag aatggtttcc tcggttacga tatttccagt       480
     cggacagcta ctatctggga tgacggcaac aagaagttca cacttactaa cgagggccat       540
     cttagcaagg ctgtcgtgtc ggtgcttcaa cgcccaaatg agactaaaaa tcaaattctc       600
     tacattgcgt ctgtcgagac cagtcagaat gagattctga acgcgttcga gaccgtcacc       660
     ggatgcaaat ggtctatcat acggacaacc actgaagagc aagtgactga ggcccgtatg       720
     aaattgagca aaggtgattt cgacggtgcc ttgaccttag ttcgggccac cagttacagc       780
     aatttacctg gcctcaagtc caattacgct aaagggttca aggtggcaaa cgatattttg       840
     ggattggaat gggcgaatgt tgaagacacg gtcaggacgg ttgtttcgaa gtaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page