(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE131

ASFUM1_6.PE131       Location/Qualifiers
FT   CDS_pept        join(complement(462632..463114),complement(462471..462560))
FT                   /codon_start=1
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI20750829"
FT                   /orf_name="AFUA_6G02460"
FT                   /product="Glucosamine 6-phosphate acetyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.4"
FT                   /function="glucosamine 6-phosphate N-acetyltransferase
FT                   activity"
FT                   /protein_id="EAL85793.1"
FT                   /db_xref="GO:0004343"
FT                   /db_xref="HOGENOM:HBG341300"
FT                   /db_xref="HOGENOM:HBG736206"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:2VEZ"
FT                   /db_xref="PDB:2VXK"
FT                   /db_xref="UniParc:UPI000051FB55"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU5"
FT                   /transl_table=1
FT                   /translation="MTNATIAPTTTAAPVTKSVDAPTADENTPLFSPSLISPDVLAVLP
FT                   ADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEG
FT                   RIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTI
FT                   LDCSEANEGFYIKCGFKRAGLEMAHYY"
     atgaccaacg caaccattgc tccgacgacg actgcagccc cggtcaccaa gtccgtcgac        60
     gctcccaccg cagatgagaa cacccccctc ttctccccct cgctcatctc ccccgatgtc       120
     cttgccgtcc ttcccgcaga ctacaccatc cgcccgctgt gtcgctccga ttacaagaga       180
     ggctacctcg acgtcctccg tgtgctgacg actgtcggcg acatcaacga ggagcagtgg       240
     aacagtcggt acgagtggat tcgcgcccgg agcgacgagt actacctgct cgttgtgtgc       300
     gacggggagg gccgcatcgt tggcacaggc agtctggtcg tcgagcggaa gttcatccat       360
     tcgctgggga tggtggggca tattgaggat attgctgttg agaagggaca gcaggggaag       420
     aagctgggac tgaggattat tcaggctttg gattacgtgg ctgagaaggt gggatgttat       480
     aagacgattc tcgattgctc agaggcgaat gaggggttct atatcaagtg tgggtttaaa       540
     cgtgctgggt tggagatggc gcactactac tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page