(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE134

ASFUM1_6.PE134       Location/Qualifiers
FT   CDS_pept        join(469439..470509,470588..470693,470753..470814)
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263253"
FT                   /orf_name="AFUA_6G02490"
FT                   /product="Aspartate transaminase, putative "
FT                   /EC_number="2.6.1.1"
FT                   /function="L-aspartate:2-oxoglutarate aminotransferase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL85790.1"
FT                   /db_xref="GO:0004069"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F666"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU8"
FT                   /transl_table=1
FT                   /translation="MSVLSTLAPVPPDEIFALNRAYATDPFPQKVSLGVGVYRTDDGKP
FT                   WPLPCVREAEKQLLAEDSLTRHEYTAIEGDIPFLELARDIMFGFDGKNAAEKHKSRIGS
FT                   VQTVAGTGANHLGALFLATHMKPGKVWLSNPSWANHMTIWELAGVPRKTYPYYNPTTRS
FT                   FDFDGMMATLEAEAQQGDVILLHACAHNPTGLDPNKEQWKAIADLCERKKIFPFFDSAY
FT                   QGFASGSLEEDAWAVRYFLNEKPGMEMCVAQSFSKNFGLYGQRVGAFHYVLPQGSESLR
FT                   DTVVVNLCHLIRGEYSMGPTAGCNLVKKVLTNEELTAQWHKDLKVMSSRIRSMRKALYD
FT                   ELLRLQTPGSWRHIVEQNGMFSYTGLTPAQVHSLKDKYHIYLLKSGRASISGLSEKNVA
FT                   YVAQAIDDVVRNV"
     atgtctgtgc tcagtacact ggcacccgtc ccaccagatg agatcttcgc cttgaatcgc        60
     gcgtatgcca cggatccttt cccgcaaaag gtcagcctgg gagttggcgt ctaccgcacc       120
     gacgacggca agccatggcc tcttccatgc gtgcgcgaag ccgagaagca actgcttgcc       180
     gaagacagtc ttaccagaca cgagtacacc gccatcgaag gcgacattcc cttcctcgag       240
     ctggctcggg acataatgtt cgggtttgat ggcaagaacg cagcagagaa gcacaagagc       300
     cgcattggtt ccgtccagac cgtcgcaggc accggcgcaa accacctcgg agccctgttc       360
     ctggcaaccc acatgaagcc cggaaaggtc tggctctcca acccatcctg ggccaaccac       420
     atgaccatct gggaactcgc aggcgtcccc cgcaagacct acccttacta caaccccacg       480
     acccgctcct ttgacttcga cggtatgatg gcgaccctgg aggccgaggc gcaacaaggc       540
     gatgtcatcc tcctccacgc ctgcgcacat aaccccaccg gccttgatcc caacaaggag       600
     caatggaagg ccattgccga cctctgcgag cgcaaaaaga tcttcccctt cttcgactcg       660
     gcctaccagg gtttcgcatc ggggtctctc gaggaggacg cctgggcggt gcgctacttc       720
     ctcaacgaga agcccggcat ggagatgtgc gttgcgcaga gcttctccaa gaacttcggg       780
     ctctacggac agcgcgtagg tgccttccac tacgtcctgc cccaaggcag cgagagtctc       840
     cgcgacaccg tcgtcgttaa tctgtgccat ttgatccggg gcgagtactc catggggccc       900
     acagcgggtt gcaacctcgt caagaaggtc ctgacgaacg aagaactcac tgcgcagtgg       960
     cacaaggatc tcaaagtaat gagctcgcgg atccgctcaa tgagaaaggc tctctatgac      1020
     gagcttctga ggctgcagac cccggggtcc tggagacaca ttgtggaaca aaatggaatg      1080
     ttctcctaca ccggcctcac ccctgcgcag gttcattccc tcaaagacaa gtatcacatc      1140
     tacctgctta agtccggcag agcttccatc agcggcttga gtgaaaagaa cgtcgcctac      1200
     gtggcccagg ccatcgacga cgttgtgcgc aacgtctag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page