(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE135

ASFUM1_6.PE135       Location/Qualifiers
FT   CDS_pept        join(complement(472710..472781),complement(471318..472619))
FT                   /codon_start=1
FT                   /gene_family="HOG000202216" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056122"
FT                   /orf_name="AFUA_6G02510"
FT                   /product="Chitin biosynthesis protein (Chs5), putative "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85789.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG252834"
FT                   /db_xref="HOGENOM:HBG326972"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI000051F8C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCU9"
FT                   /transl_table=1
FT                   /translation="MLVSLTVGKVDAGVAVLLTQDNRLDSTLLVRTVGRFTAANLGNLQ
FT                   IEFPSVLLPNSITSGSIVDITVSRNHAAEAASTSAFQALQKRILNTYGVKTPAPPVLRL
FT                   RNATQTSLVLEWDPIDLATASLKSLSLYRNGSKAGSIPRPLETRSTKISGLAIDTEYSF
FT                   HLVLRTTAGTYQSEKLTCRTHKMTDLSGITVTPGVLPEQQKEALAAALERIGGKMIDTV
FT                   RIDTTHFVCTEGRGPLWEKAVEMNIPVVVPEWVDACEAEGTIVGVRGYYLNADPKARQL
FT                   GPIHASTHQHTRSSVSMATNAPSQSQSQSQSQPQSQSQSRLSLQPQPTHQRELSVGDPP
FT                   VTPFPGADMSGQPRADEREVSSDEEDLPPPPPPKDDAAGAEPAVNGKPESTSPEGVVSS
FT                   GDKEERSESDEKHDEKDEDETAHEQAEEKQEQEEPTSNDSDAKGKGKEGEGDFSEISL"
     atgttggtct ccttgacagt aggcaaggta gacgcaggag ttgctgtgct cttgacgcag        60
     gataaccgac tcgattctac cttactagta aggactgttg gacgattcac ggctgctaat       120
     ctcggcaatc tacagatcga attcccctcc gtccttctcc cgaacagcat cacatctggc       180
     agcattgtcg atatcacagt atcgcgcaac catgccgctg aagctgctag cacttcagcc       240
     ttccaggcgc tacagaagcg gattctcaac acctacggcg tgaagacccc tgcccctcct       300
     gtcctccggc tccgcaacgc aacacaaacc tccctagtcc tagaatggga tccaatcgac       360
     ctggccactg cgtcgctcaa gtcgctttct ctctaccgca atggctcgaa agctggttcg       420
     ataccaaggc cgctcgagac acggagcacc aagattagcg gcctcgccat cgacacggaa       480
     tattccttcc acctcgtcct gcgcacaaca gccggcacat accaatcgga gaaactgaca       540
     tgtcggacac acaagatgac cgatttgtcc ggtatcacgg tgacccctgg cgtcctcccc       600
     gaacagcaga aagaggcgct cgccgcggct ttggaacgta ttggcggcaa gatgatcgac       660
     acagtgcgca tcgataccac tcactttgta tgtacagaag gcagaggccc gctgtgggag       720
     aaagcggtgg agatgaacat tcccgtcgtg gttccggagt gggtggatgc ctgtgaagcc       780
     gagggcacca tcgtcggagt ccggggctac tacctgaatg cagaccccaa ggccagacag       840
     ctcggcccca tccatgcctc gacacatcaa cataccagat cctccgtgtc gatggcaacc       900
     aatgcgccat ctcagtctca gtctcagtct caatcccaac cccaatcaca gtctcagagt       960
     agactgagcc tccagcctca acctacgcac cagagggaat tgagcgtcgg ggaccccccc      1020
     gtgactccct tccccggtgc agatatgagt ggccagcctc gagcggatga gagagaggtc      1080
     tcatcggatg aagaggactt gccgccgccc cctcctccga aggatgatgc tgcaggtgct      1140
     gaacccgctg tgaacggcaa acctgagtcg acaagcccgg agggagttgt ctcttctgga      1200
     gacaaggagg aacggagtga aagtgacgag aaacatgacg aaaaggatga agatgaaacc      1260
     gcacacgaac aggccgaaga aaagcaggaa caggaagaac cgacatcaaa cgacagtgat      1320
     gccaagggta aggggaagga aggtgagggg gactttagcg agatttctct gtga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page