(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE136

ASFUM1_6.PE136       Location/Qualifiers
FT   CDS_pept        complement(473217..473759)
FT                   /codon_start=1
FT                   /gene_family="HOG000202205" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902855"
FT                   /orf_name="AFUA_6G02515"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27243.1"
FT                   /db_xref="HOGENOM:HBG325070"
FT                   /db_xref="UniParc:UPI0000F51CE7"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA25"
FT                   /transl_table=1
FT                   /translation="MMTGQTVQRKLVKSTSQFYMRYNPKAVLPPVASRYILSETHPIRP
FT                   KIQHLYANRDPSTLWWRVNPQPLQSFKRVVRSWATRRARLAFRQALAAQGFDAEGRRLV
FT                   SEASGSMATRSPKEGLQGSLEIAVLPQSVKAGYDTIRKEMDYLLRTLLRHLRDGKKQTN
FT                   TFRKQGEDHKRIPTNTS"
     atgatgaccg gacaaactgt acaaaggaag cttgtcaaaa gcacaagtca attctacatg        60
     cgctataacc ctaaggcagt cctaccacca gttgccagtc gatatatcct ctctgagaca       120
     catcccatcc ggcccaagat ccaacatcta tacgccaacc gggatcctag tacactgtgg       180
     tggagggtaa atccacaacc gctgcagtct tttaagcgag tggttcgttc atgggctaca       240
     aggcgggccc gattggcgtt tcgacaagcc ctggcagcgc aagggttcga cgccgaaggt       300
     agaaggttgg tgtcagaggc ctcgggatct atggctacga gatcaccaaa ggaaggtctc       360
     cagggtagcc tggagatcgc tgtccttccg cagagtgtga aggcgggata cgacactatt       420
     cggaaggaga tggattatct tttaagaacg ttgctgaggc atttgagaga cggcaagaag       480
     cagacaaata cctttcgcaa gcagggggaa gatcataaga ggatacccac aaacactagt       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page