(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE144

ASFUM1_6.PE144       Location/Qualifiers
FT   CDS_pept        join(491908..492092,492134..492518)
FT                   /codon_start=1
FT                   /gene_family="HOG000048646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263259"
FT                   /orf_name="AFUA_6G02575"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85782.1"
FT                   /db_xref="HOGENOM:HBG056325"
FT                   /db_xref="UniParc:UPI0000520937"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV6"
FT                   /transl_table=1
FT                   /translation="MVENKFIKVDRESFPYVFVKDVDISLKTHEKGLAQVDWPIPDTQY
FT                   TKFFLTPKQTLLQISDILPRTSDLVLPDAHLGSAGRPSLFGIRRPQHWRSPATYRYISP
FT                   FSAPEQSKSRLRRTISTCSSRCARECGREASLYTGTMGDPVPIMKGWLRVSLREVNENH
FT                   PFHCDYLPHRDYASADVQPVKAGEKY"
     atggtcgaga acaaattcat caaagtcgac cgcgaaagct tcccctatgt ctttgtgaag        60
     gacgtggaca tttctctgaa gactcacgaa aaagggcttg cacaagtgga ctggcccatc       120
     ccggatactc agtacaccaa gttcttcctc acgcctaagc agaccctttt acaaatttct       180
     gatattcttc cccgcacatc ggaccttgtg ctccctgatg ctcacttagg atctgcaggc       240
     cgcccatcac tttttggtat ccgacgccct caacactgga gatcaccagc cacatatcgt       300
     tacatctcac cgttttctgc tcccgagcaa agcaagagtc gcctccgccg tacgatatcg       360
     acctgttcgt cacgctgcgc aagggaatgc ggacgggaag caagtctata cactgggact       420
     atgggcgatc cagttccgat catgaaggga tggctacgtg tctcgcttcg cgaagtcaat       480
     gaaaaccacc cattccactg cgactatctc ccacatcggg actatgctag tgctgatgtt       540
     caacccgtga aggcgggaga gaagtattag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page