(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE145

ASFUM1_6.PE145       Location/Qualifiers
FT   CDS_pept        493180..494400
FT                   /codon_start=1
FT                   /gene_family="HOG000234671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263260"
FT                   /orf_name="AFUA_6G02580"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85781.1"
FT                   /db_xref="HOGENOM:HBG056323"
FT                   /db_xref="HOGENOM:HBG332065"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniParc:UPI000051F40D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV7"
FT                   /transl_table=1
FT                   /translation="MQIPKPFLGGVAGAFVLLQLLFLANMSYLYGSAYHDSYRISSMNV
FT                   LFVDYDQGVIGESVAAAYSQMQGDSFPTLRQHPPSEYPSQYSIRQAVCEGHFWGAIYAN
FT                   PGASSRLSSALSSPDVAQTYDSSQALTYVWNGVKYASYAQIISSSLQMLAHAATGAYQQ
FT                   INGTKAMGAVDTLNPAIAHTLLNPIAASSIDIKPTNQGVRFYYNTVSMVMPILQQFFFI
FT                   MALNGLTAEFGVVLRTMSLRGSIVLRLTLSVLYTFIAALCMTGYIWGFREAWAVTGGQF
FT                   ALTWMAIWLVMHLNFLLIDAVTSVLPMKFMPFAILTWIIINVSSTIGPFDLSPGFYRLG
FT                   YALPAYELYQLLLDIWTEGCNPPLYRELPILFAWWVVGFVAFLAGMRKRVLAARADYVE
FT                   TRRTDKA"
     atgcagatac cgaaaccctt cctaggagga gtggccgggg cgttcgtcct cctgcaactc        60
     ctcttcctcg cgaacatgtc ctacctgtac ggatctgcat accacgattc gtaccggatc       120
     agcagcatga atgtgctctt tgtcgattat gaccaaggtg ttattgggga atcagtggca       180
     gccgcctaca gtcaaatgca aggcgacagc ttcccgacgc tccgccagca cccgccatcc       240
     gaatatccct cccagtacag catacgacaa gccgtctgcg agggccactt ttggggagca       300
     atctacgcca atccgggggc ctcatcgcgt ctctcgtccg ccctcagctc gccagacgtc       360
     gcccagacat acgacagctc ccaggcgttg acatacgtct ggaacggagt caagtacgcc       420
     tcctatgcgc agataatctc atcgagcctc cagatgttgg cccacgcagc tacaggcgcc       480
     taccagcaga tcaacggcac caaggccatg ggcgccgtcg acacactcaa cccggccatt       540
     gcgcacactc tgctcaaccc catcgccgca tcgtcgatcg acatcaagcc gacgaaccaa       600
     ggcgtccggt tctactacaa caccgtgtcg atggtgatgc cgatcctgca gcagttcttc       660
     ttcataatgg ctttgaacgg cctcaccgcc gagtttgggg tggtcctccg aacaatgtct       720
     cttcgcggca gtatcgtcct ccgcctcacc ctctccgtct tgtatacttt catcgcggcc       780
     ctctgcatga cgggctacat ctgggggttc cgcgaagctt gggctgtcac gggcggccag       840
     ttcgccctga cgtggatggc gatctggctg gtcatgcacc tgaacttctt actgatcgac       900
     gctgtgacca gcgtgcttcc gatgaagttc atgccgttcg ccatcctcac ctggatcatc       960
     ataaatgtct ccagcaccat cgggccgttt gatctttcgc caggcttcta ccggctcgga      1020
     tacgccctgc ctgcgtatga gctctatcaa ctgctcttgg atatctggac ggagggttgt      1080
     aacccgcctc tataccggga gctgccgatc ctgttcgcgt ggtgggtggt tggatttgtt      1140
     gcattcttgg ctggaatgcg gaagcgcgtt ctcgcagcga gggcagatta cgtcgaaacc      1200
     cgtaggacag acaaggcctg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page