(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE147

ASFUM1_6.PE147       Location/Qualifiers
FT   CDS_pept        join(498109..498126,498177..498457,498585..498848,
FT                   498902..499156,499213..499282)
FT                   /codon_start=1
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263261"
FT                   /orf_name="AFUA_6G02600"
FT                   /product="Phosphoglycerate mutase family protein "
FT                   /EC_number="5.4.2.1"
FT                   /function="phosphoglycerate mutase activity"
FT                   /protein_id="EAL85779.1"
FT                   /db_xref="GO:0004619"
FT                   /db_xref="HOGENOM:HBG469482"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000051F8D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCV9"
FT                   /transl_table=1
FT                   /translation="MFDYQLRNLGFLTYLLSVATKVDSIKRRTLKSVIANTRGKEMTPR
FT                   CFIVRHGETEWSLNGRHTGSTDLPLTANGEKRIKATGKALVGNDRLIVPKKLAHVYVSP
FT                   RTRAQRTLELLEIGCKERLPWTEARKSEEEEPIRTEAKVEITDAIREWDYGDYEGLTSK
FT                   QIRELREKNGQGPWDIWRDGCPGGETCTAQLMKVNPDRSPEDVIRRLDALIAEIREKFH
FT                   NKYFEGSSGGKGDVLIVAHGHILRAFAMRWTGKPLSETTLILEAGGVGTLSYEHDNIHE
FT                   PAIILGTAGFVVEE"
     atgtttgatt atcagcttcg aaatcttgga ttcctaactt acttactttc tgtcgctacc        60
     aaggttgatt ccattaagcg tcgcacactg aaatcagtca ttgcgaatac aaggggaaaa       120
     gaaatgacac cccgctgctt cattgtccgt cacggcgaga cagaatggtc cctaaacggg       180
     cggcacaccg gctccaccga cttgccgttg acagcaaacg gcgagaaacg gattaaggcg       240
     acgggcaaag cgttggtcgg caatgaccgg ctgatcgttc caaagaagct ggcacatgtt       300
     tacgtatctc cccgcacccg cgcccaacgt accctcgagc tcctcgaaat cggctgcaaa       360
     gagagactcc catggaccga ggccagaaaa tcagaagagg aggaacccat acgcacggaa       420
     gccaaggtgg aaatcaccga cgcgatcagg gaatgggact atggcgatta tgaaggattg       480
     acgagtaagc agatcagaga gctgcgggag aagaatggcc aggggccgtg ggatatctgg       540
     agggacggat gtccaggcgg agagacttgc acagcgcagc tgatgaaagt gaacccggac       600
     agatccccgg aagacgtcat tcgtcgactt gatgctttaa tcgccgagat tagggaaaaa       660
     ttccacaata aatactttga gggctcgtct ggcggcaaag gagatgttct gatcgtcgcc       720
     cacggccata ttctgcgcgc gtttgccatg cgctggaccg gaaagccact ctccgagacg       780
     acattgatct tggaagctgg cggagtcggc accttgagtt acgaacacga caacatccac       840
     gaaccggcaa tcattctcgg tacggccggt ttcgtcgtag aagagtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page