(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE15

ASFUM1_6.PE15        Location/Qualifiers
FT   CDS_pept        join(75194..75326,75386..75616,75768..76288)
FT                   /codon_start=1
FT                   /gene_family="HOG000048662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262210"
FT                   /orf_name="AFUA_6G00250"
FT                   /product="GPI anchored protein, putative "
FT                   /protein_id="EAL84240.1"
FT                   /db_xref="HOGENOM:HBG056457"
FT                   /db_xref="UniParc:UPI000051ED5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X9"
FT                   /transl_table=1
FT                   /translation="MHAVATVTWGAAVGLALGQLTELKTMELELNAYDTILLYVPRVMN
FT                   VQANSLPYKRDEEEGDDESYGSGNSEDRQEQRLQAVFSEDYFQQIIRLLTALARLPALK
FT                   SLSLRDYYSQPVRHEYVTRSILNMVFHTPEVFGKRLGDVQYRNPLPHMSIEAVCIALLT
FT                   HAKFSLRHLDIELLENGSMCGCRHEPFLEPYRPYLSINPTAPPTTNWRWNEFTQLERLT
FT                   LDIHLFSNLEGNGWLPFAQTLPASIQDVVILAPRCPPGADMLDFQNMFHDFNPQNFSIF
FT                   RPINAVATSTLGL"
     atgcatgcag tggccactgt cacttggggg gctgcagtgg gacttgccct tgggcagttg        60
     acagagctga agacaatgga actggagttg aacgcctacg atactatcct tctctatgtc       120
     cctcgcgtta tgaacgtgca agccaactcc ctaccttata agcgagacga ggaggaaggc       180
     gacgatgaat cgtatggatc cggaaatagt gaggatagac aagagcaacg tttacaggca       240
     gttttcagcg aagattactt tcagcagatc atccgcctct taactgcgtt ggctcgattg       300
     ccagctctta aaagcctctc gctcagggat tactactcac agccagttcg gcatgaatat       360
     gtgaccagaa gtattttaaa tatggtcttc catacgccag aggtatttgg caaacgcctt       420
     ggagacgtac aatatcgaaa ccctctgccc cacatgagta ttgaggccgt gtgtatagca       480
     ctgcttaccc atgccaaatt tagcttacga cacctcgaca ttgaactcct ggagaatggt       540
     tccatgtgtg gctgtcgcca cgaacctttc ctggagccat accgtcccta tctgtcgata       600
     aacccaaccg caccgccgac aacaaactgg agatggaacg aattcaccca gctagagcgg       660
     ctcacccttg acattcatct gtttagcaat cttgaaggga atggatggct cccgttcgcg       720
     cagacccttc ccgcttccat tcaggacgtt gtgatcctgg ctcctcgctg ccctccagga       780
     gcagatatgc tagacttcca gaacatgttt catgatttca acccccagaa cttttcaatc       840
     tttcggccaa tcaacgcggt ggcgacgtct acactgggat tataa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page