(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE151

ASFUM1_6.PE151       Location/Qualifiers
FT   CDS_pept        complement(513117..513395)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263264"
FT                   /orf_name="AFUA_6G02640"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85775.1"
FT                   /db_xref="HOGENOM:HBG056320"
FT                   /db_xref="UniParc:UPI0000520929"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW3"
FT                   /transl_table=1
FT                   /translation="MSSTFAGIWDDSGHDMDCRSRQRTDCTSCLLGIGQLVPLREAEGS
FT                   IVKHQQDYGFQWREEGDSVSPPCAPDLSTSDRGDYFECVENKALAFT"
     atgtcaagca cattcgcagg gatatgggac gacagtggtc acgacatgga ttgccgaagc        60
     aggcagcgta cagactgcac atcttgtttg ctgggcattg gccagctggt accattaaga       120
     gaagccgaag gcagcatcgt caagcaccaa caagattatg gctttcaatg gagggaggaa       180
     ggtgacagcg tctcaccacc gtgtgctcca gatctcagca ctagcgaccg cggcgattat       240
     ttcgaatgcg tagaaaacaa agctctagcg ttcacttaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page