(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE155

ASFUM1_6.PE155       Location/Qualifiers
FT   CDS_pept        join(521343..521579,521687..521772,521841..523407)
FT                   /codon_start=1
FT                   /gene_family="HOG000202106" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056124"
FT                   /orf_name="AFUA_6G02680"
FT                   /product="Ankyrin repeat and BTB/POZ domain protein "
FT                   /protein_id="EAL85771.1"
FT                   /db_xref="HOGENOM:HBG191648"
FT                   /db_xref="HOGENOM:HBG397648"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051EA6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW7"
FT                   /transl_table=1
FT                   /translation="MMTERTVLRKDQLEISLHNEKKLIQEGTIKDDNPLDLSEPFRELC
FT                   EACRKGDLKVCQEKITEGVNVNARDPYDYTPLILASLCGHYEVAQLLLESGALCERDTF
FT                   QGERCLYNALNDRIRNLLLEYDYSKSTDPLQPLAAHVSSLLTRDQPGTSDIVVTAGDES
FT                   LYLHKFILAARSPYFRGKLVADPKSTTWKLPSTIPPQAFGTAIKYLYFGEAPRDLRSGP
FT                   GTGFTESEVFAGIDRISKHLEIPSLLDSILDSGDRRLARQRRSMELSRGRDQLEEWFRK
FT                   NVLGSKIEVNSSKVDGFRWDRHNGIFADVVLRADELREDEDDICDGFNLNGKQQDRKSV
FT                   LFPCHRAMLLRSEFFQAMFSSTFREAHLKEHLNVIPVDCSPEVLEIVLTFLYTERADFP
FT                   LDIAVDVLFAADMLFIEKLKTKAAVVISTLGSGDMSQAEAARTRGTKEEDEIDIYAIIR
FT                   AAWLTRVQRLEEFAARYLAYRLEAHIDSPEFAELIQESAARIKARQETDSIELLDDIRF
FT                   YLGERFRLRFDDAGLEEMMEEEQRQQLADSSGVDKDLVEITDKVDTMGIQSQTLPIGAE
FT                   AEVTPGEMIREQGPIIRTLDGEIAGDEFSKDAINYQILMEKLDLLLKELNLEA"
     atgatgacag agaggactgt attacgcaaa gatcaacttg aaatcagtct ccacaatgaa        60
     aagaaactga tccaggaggg gacaattaag gatgacaacc ctcttgatct gagcgagccg       120
     tttcgggaac tttgcgaagc gtgtcgcaag ggggacctga aagtctgcca ggaaaagatc       180
     acggaaggag ttaatgttaa tgctcgggat ccttacgact atactccctt gattctagca       240
     agtctctgtg gtcattatga ggttgctcag ctccttcttg agtccggtgc actgtgtgaa       300
     cgtgacactt ttcaaggaga aagatgccta tataacgctt tgaacgatcg tatacgaaat       360
     ttactgcttg aatatgatta ttcgaaatct accgatcccc ttcagcccct tgccgcccat       420
     gtatcgtcgc tactcactcg agatcaaccc gggacgtctg atattgtggt gacagctggt       480
     gatgagtccc tgtatttgca caaatttata cttgctgcac gttctccgta ctttcggggt       540
     aagttggtag ctgaccccaa gtctacgaca tggaaactgc cgagcacgat cccgccgcaa       600
     gcattcggga cggcaattaa gtacctgtac tttggagagg ctcctcgcga cttgagaagc       660
     ggacctggta cggggtttac agagtcagag gtcttcgcag ggattgacag gatctccaag       720
     cacttggaga ttccgagtct gctggacagc atcctcgaca gtggtgacag gaggttagcc       780
     aggcagcgaa ggtcaatgga gctttcaaga ggtcgagatc agctcgaaga atggttccgc       840
     aagaatgtcc ttggaagtaa aatagaggtc aattcctcca aggtagatgg tttcagatgg       900
     gaccgtcaca atgggatctt cgctgatgtc gtgcttcgag ccgacgagct ccgtgaagac       960
     gaggacgaca tttgcgatgg cttcaatcta aatggaaaac agcaagacag gaaatcagtt      1020
     ttgtttccct gccaccgggc catgctgctt cggtccgagt tctttcaagc tatgttttcg      1080
     tctaccttcc gagaggcaca cctgaaggag cacctgaatg tcatacctgt ggattgctct      1140
     cctgaggttc tggagattgt gctaacgttt ctgtacacgg aaagggcgga tttcccactt      1200
     gatatcgctg tcgacgttct tttcgccgct gatatgctgt ttatcgagaa attaaagacc      1260
     aaggcagcgg tcgttatcag cacacttggc agcggtgaca tgtcacaggc agaagctgca      1320
     aggactcggg gtaccaagga agaagatgag attgatatct acgctatcat ccgcgctgct      1380
     tggttgactc gagtccagcg attggaggag ttcgctgcac gttatcttgc gtaccgattg      1440
     gaagctcata ttgactcacc tgaattcgct gaactgattc aagagtcagc agctcgtatc      1500
     aaggcaagac aagaaactga ctccattgag ctgttggacg acatccggtt ctacttgggc      1560
     gagcgcttcc gacttagatt cgatgatgct ggcctggaag agatgatgga agaggaacaa      1620
     cgacaacagc tggctgattc tagtggcgtc gacaaagact tggtagagat taccgataaa      1680
     gtggacacaa tgggcattca aagtcagact ctgcccatcg gcgcagaagc agaggtcacg      1740
     cctggtgaaa tgattagaga acaaggcccc atcatccgga ctctggatgg agaaattgct      1800
     ggcgatgaat tcagcaagga tgcgatcaac taccagatcc tcatggagaa actggatctc      1860
     ctcttgaaag agctgaactt ggaagcttga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page