(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE156

ASFUM1_6.PE156       Location/Qualifiers
FT   CDS_pept        join(536693..536966,537031..537767)
FT                   /codon_start=1
FT                   /gene_family="HOG000202095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750831"
FT                   /orf_name="AFUA_6G02690"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85770.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056315"
FT                   /db_xref="HOGENOM:HBG326998"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000052021D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCW8"
FT                   /transl_table=1
FT                   /translation="MDVASLISPSESDTVPTFRSRSIQNSSASHYKRLSEQSTGSYFSA
FT                   VPTHTTSYSRTPQPPLSPPAEDQSKCSLPSISILLENADGAAAHAAKRQRNSLSTHRDS
FT                   DPRPPYDSITPHAMPPTPPLRPGSGFHSNGHSPSTSSVSAASSSALMKNTESYPQAPIG
FT                   LPSPTDRSSISSQGSVQHAASAPYASPAPSVSSFSSPIEPSTPSTAAYYQRNPAPNTFQ
FT                   NPSPFPQTSTASLPSPGHQQMISPVTPAWQHHHYFPPSSSTSYQQNHDRYICRTCHKAF
FT                   SRPSSLRIHSHSHTGEKPFRCTHAGCGKAFSVRSNMKRHERGCHTGRPVATAMVQ"
     atggatgtcg caagcctcat ctcgccttct gaatcggata ctgtcccgac cttcaggtca        60
     agatcgattc agaattcatc agccagccat tacaagcgcc tctccgaaca atcaacaggc       120
     tcttacttct ctgctgtgcc aacacataca acgtcttact ctcgtacccc tcagccacca       180
     ctgtcccctc cagcggagga ccagtccaaa tgctcgcttc cttccatctc gatcctgctt       240
     gagaacgcag acggtgccgc cgcacacgca gcaaaacgcc aacgaaacag cctatcaacg       300
     cacagggatt cggatccccg gcctccatat gactcgatca caccacacgc catgccgcca       360
     acgccgccat tgcgtcccgg ttcgggcttc cacagtaatg gccattctcc ctcgacatca       420
     tctgtctctg ccgctagctc cagcgctttg atgaaaaaca cagaatcgta tcctcaggcg       480
     ccaattgggc ttcctagtcc aacggatcga tcctcgatct cgagccaagg gtccgttcag       540
     catgccgcca gcgctccata tgcttcgcct gctcccagcg tatcgtcctt ctcttctccc       600
     atcgagccct ctacaccatc aactgccgct tactaccaaa gaaatcctgc gccgaacacc       660
     ttccaaaacc caagcccctt cccccaaaca tccacagcat ctcttccctc cccgggtcat       720
     caacagatga tttctcccgt cacccccgcc tggcaacatc accactactt ccccccgtcc       780
     agttccacgt cttaccagca gaaccatgat cgctacatct gccggacatg ccacaaggcc       840
     ttttcgcggc cctccagcct gcgcatccac tcccacagcc acactggcga gaagcctttc       900
     cgttgcacac atgccggctg cggcaaggcc ttcagcgtac ggagcaatat gaagcgtcat       960
     gagcgtggtt gccatacggg ccgcccagtt gctaccgcca tggtccaata g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page