(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE158

ASFUM1_6.PE158       Location/Qualifiers
FT   CDS_pept        join(542777..542890,542957..543142)
FT                   /codon_start=1
FT                   /gene_family="HOG000202071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902859"
FT                   /orf_name="AFUA_6G02705"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27241.1"
FT                   /db_xref="HOGENOM:HBG325068"
FT                   /db_xref="UniParc:UPI0000F51CE8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA23"
FT                   /transl_table=1
FT                   /translation="MPAPKNVQKLVLAAAVTSITIAGTLYGASVKTEQEVTKTVQKSRE
FT                   ATIDERIASLRAMRQNLTSKKELVERQIDDLEKRIQERAQKGLGEKKETPHNGR"
     atgcctgctc ctaaaaatgt acagaagctt gtcttggctg ctgccgtcac gtcaatcacc        60
     atcgcaggaa cactctacgg cgccagcgtc aagaccgaac aagaggttac caagacggtc       120
     cagaaatctc gagaagctac aattgacgaa cgaattgcgt cactacgggc catgcgacag       180
     aatctgacgt ctaagaagga acttgtcgag agacagatag acgaccttga gaaaagaatc       240
     caagagaggg cgcagaaggg ccttggcgag aaaaaagaga caccccataa tggacgatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page