(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE163

ASFUM1_6.PE163       Location/Qualifiers
FT   CDS_pept        join(complement(559625..559767),complement(559248..559420),
FT                   complement(558922..559166))
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263270"
FT                   /gene_name="egd1"
FT                   /orf_name="AFUA_6G02750"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   beta"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85764.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG244178"
FT                   /db_xref="HOGENOM:HBG629031"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI0000520214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCX4"
FT                   /transl_table=1
FT                   /translation="MDQAKLARMQASVRIGTFCSFLWIFEVLESESVFSADGFQAHHLG
FT                   NVIGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAP
FT                   KVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGAEG
FT                   KKDEDEDDIPDLVEGENFESNVE"
     atggatcaag caaagctggc taggatgcag gcgagcgtgc ggattggtac gttttgttct        60
     ttcctttgga ttttcgaggt gctggagtcc gaatcggtgt tttctgcgga tggtttccag       120
     gcgcaccatc tgggcaatgt gataggaaag ggtactcccc gccgcaaggt caagaaggtc       180
     cacaagtcct ccggtgccga cgacaagaag ctccagacca ccctgaagaa gatgaacgtc       240
     cagcccatcc aggccatcga ggaggtcaac atgttcaagg aggacggaaa tgtcatccac       300
     ttcgccgccc ccaaggtcca cgcctccgtc ccctccaaca ccttcgccct ctacggtaac       360
     ggcgaggaga aggaactcac cgagctcgtc cccggtatcc tcaaccagct tggccccgac       420
     agccttgcct ccctgcgcaa gctcgccgag agctaccaga acatgcagaa gcaggccggt       480
     gccgagggca agaaggacga ggatgaggac gatatccctg acctggttga gggcgagaac       540
     ttcgagagca atgttgagta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page