(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE173

ASFUM1_6.PE173       Location/Qualifiers
FT   CDS_pept        join(complement(580809..580906),complement(580521..580752),
FT                   complement(580425..580454))
FT                   /codon_start=1
FT                   /gene_family="HOG000076291" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750833"
FT                   /orf_name="AFUA_6G02845"
FT                   /product="Ethanolamine utilization protein (EutQ), putative"
FT                   /protein_id="EAL85754.1"
FT                   /db_xref="HOGENOM:HBG304734"
FT                   /db_xref="HOGENOM:HBG568350"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FDB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY4"
FT                   /transl_table=1
FT                   /translation="MTVPFRYHAKAQSTFKPPLIANENAFLGDVYSSEKENPDKPISAG
FT                   FYRLEKGTPLVYEYTYDEMKIILEGQFEIADETGQKVTALPGDVFYFPKGAKITFTTQT
FT                   YGLAFYTGQRKQGGA"
     atgaccgtcc cattcagata ccacgccaaa gcccaatcca cctttaagcc acccctgatc        60
     gcaaacgaga atgccttctt aggcgatgtg tactcgagcg agaaagagaa ccctgacaag       120
     cccatctcgg ctggcttcta ccgcctggaa aaaggaaccc cgctggtgta tgaatacacc       180
     tacgatgaga tgaagattat ccttgagggg caatttgaaa ttgccgacga aaccgggcag       240
     aaggtgacgg ctttgccggg ggatgttttt tattttccca agggggcgaa gattacgttt       300
     acaacgcaaa catatgggtt ggcgttctat actggacaga ggaaacaggg aggtgcctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page