(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE176

ASFUM1_6.PE176       Location/Qualifiers
FT   CDS_pept        join(complement(592672..592740),complement(592097..592582),
FT                   complement(591719..592039),complement(591373..591667),
FT                   complement(591294..591322))
FT                   /codon_start=1
FT                   /gene_family="HOG000201950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902861"
FT                   /orf_name="AFUA_6G02870"
FT                   /product="Putative uncharacterized protein "
FT                   /cellular_component="cell outer membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85751.1"
FT                   /db_xref="GO:0009279"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056303"
FT                   /db_xref="HOGENOM:HBG326957"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniParc:UPI000051F8C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCY7"
FT                   /transl_table=1
FT                   /translation="MGRTVDQEVHAAFVEFRAKEDDKCLSVQCIYCQQIRAKNTSRQKQ
FT                   HLLECPGLRGQNQTAQTAPNGIGGANGYSATPNGAAATAPGAGPGGPGTAALPTPNGPM
FT                   MTNGVNPHATSMQTPLQNMQGRAALPTPGPPTGPASATSSHQPTRATPKSKTKASTSNL
FT                   PAPPLDDVHAAFVEFRAKEEDKCLSVQCIYCQQVRAKNTSRQRQHLLECPTYLSVMKDS
FT                   IPANNLLHTFPEGDIARSLQIPAPTLELDFRMSIKMNPKVVVGPSIWGQRDWVTFIGGQ
FT                   WAGRWGKGIVLPGGQDSQIVTKESVTHMRSNYVLQTADDPPAFIIVKTEGWLTGAKDVL
FT                   DKVNDPNIADTINPNTYKYRLNLSMETGDERYAFLNTLMWVASGCRRGHEVIFDAFRVN
FT                   "
     atgggtcgta ctgtcgatca ggaagttcac gccgcgttcg tcgagttccg cgccaaggaa        60
     gacgataagt gtctttcagt ccagtgcatc tattgccagc aaattcgcgc aaagaataca       120
     tcgcgccaga agcagcacct gcttgagtgt cccggacttc gcggtcagaa tcagacagca       180
     caaactgcgc ccaacggcat cggtggtgca aatggatatt ccgcaactcc gaatggtgct       240
     gctgccacgg cacctggcgc tggcccagga gggcctggca cagctgcact tccgactcct       300
     aacggaccta tgatgacgaa cggcgtcaac ccacatgcta cctcgatgca aactccgctg       360
     cagaacatgc aaggacgcgc cgcattgccg actcccggcc ctcccaccgg acctgcatct       420
     gctactagct cccatcaacc gactcgcgcc acccccaagt cgaagaccaa ggcctccact       480
     tcaaatctcc cagctcctcc tctagatgac gttcatgctg catttgtcga gtttcgtgcg       540
     aaggaggaag acaagtgttt gtccgtgcaa tgcatctatt gccagcaggt tcgcgcgaag       600
     aacaccagca gacagcgcca gcacctcctg gaatgcccca cctaccttag tgtcatgaaa       660
     gactcgatcc ctgccaataa cctcttgcat acattccctg aaggtgatat cgctcggtct       720
     ctgcaaattc ccgctcctac tctggaattg gacttccgta tgagcatcaa gatgaacccg       780
     aaagttgttg tcggtccgag tatctggggt cagagagatt gggtaacatt tattggtggt       840
     caatgggcgg gccgatgggg caaaggcatt gttttgcccg gaggacagga ctcgcagatc       900
     gtgaccaagg agtctgttac ccacatgcgg tcgaactatg tgctccagac cgcagatgat       960
     ccaccagcct tcatcattgt caagactgaa ggatggctga caggcgccaa agacgttctg      1020
     gataaggtca acgaccctaa tattgcggac acaatcaatc ccaacaccta caagtatcgc      1080
     cttaatcttt ccatggaaac tggagatgag cgttatgctt tcctgaacac tctcatgtgg      1140
     gttgccagtg gttgccgcag gggccatgaa gttatcttcg atgcattccg cgtcaactag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page