(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE18

ASFUM1_6.PE18        Location/Qualifiers
FT   CDS_pept        82982..83917
FT                   /codon_start=1
FT                   /gene_family="HOG000254185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262212"
FT                   /orf_name="AFUA_6G00280"
FT                   /product="NmrA-like family protein "
FT                   /EC_number="1.3.1.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84237.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056438"
FT                   /db_xref="HOGENOM:HBG334425"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E42D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y2"
FT                   /transl_table=1
FT                   /translation="MAGCAKILVIGAGELGNQVLHALAQHPNRGGATIAVLLRPSSIAS
FT                   THPDKVKELEELRNLNVQLIPGDIAKDSEEQLSDIFGEYGTIIGCTGFAAGSGTQLKLT
FT                   RAVLAAQVPRYVPWQFGVDYDIIGRGSAQDLFDEQLDVRDLLRSQNRTKWAIISTGMFT
FT                   SFLFEPWFGVVNFKGDTVTALGSLDTKVTVTAPEDIGRITAEAVLGSRADSVFGDKPIY
FT                   VAGDTLTYEQLGQLVERITGRKFTRHVRTVEAARADLARDPGNTLFKYQIVFGEGRGVA
FT                   WDLSETWNCQVGIRALTAEEWARRNLQNIM"
     atggctggat gtgcgaagat ccttgttata ggcgcaggcg agttgggcaa ccaggtctta        60
     catgctcttg ctcagcatcc taatcgaggt ggcgcaacta ttgctgtttt actacggccc       120
     tcgagcatcg catccaccca tccggacaaa gtcaaggaac tcgaggaact gcgcaatctg       180
     aatgtgcaac tgattcctgg tgacattgcc aaagattccg aggagcaact ctcggacatc       240
     tttggtgagt acggcacaat catcggctgt accggctttg cagctggctc tggcactcag       300
     ctcaaactta cgcgtgctgt tctggcggct caggttccgc gatacgtgcc ctggcaattc       360
     ggagtcgatt acgatatcat cggacgggga tccgcgcaag atctattcga tgagcagcta       420
     gatgtgaggg atctactgcg ctcccaaaac cggacgaagt gggcgatcat atcgacgggc       480
     atgttcacga gcttcttgtt tgagccttgg tttggtgtcg tcaacttcaa gggcgatacc       540
     gtaacggccc ttggaagtct tgataccaag gtgactgtca cagcaccgga agatatcggc       600
     aggattactg ccgaggctgt gcttggctcg agagctgact cggtcttcgg tgacaagccg       660
     atctatgtgg ctggagatac cttgacttat gagcagctgg ggcagttagt ggagaggatc       720
     accggccgca aatttacgag gcatgtaaga acagtggagg ctgctcgggc tgaccttgca       780
     agggaccctg gcaacacctt gttcaaatat cagatcgttt ttggtgaagg gcgtggtgta       840
     gcatgggatt tgtcggagac gtggaactgt caggtcggga tccgtgctct gactgcggag       900
     gaatgggccc gacgaaatct gcagaatatc atgtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page