(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE182

ASFUM1_6.PE182       Location/Qualifiers
FT   CDS_pept        join(613387..613686,613745..613917,613973..614133,
FT                   614241..614662)
FT                   /codon_start=1
FT                   /gene_family="HOG000236849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263280"
FT                   /orf_name="AFUA_6G02950"
FT                   /product="Aromatic ring-opening dioxygenase LigB subunit,
FT                   putative"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="EAL85743.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG058265"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniParc:UPI000051FFDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCZ5"
FT                   /transl_table=1
FT                   /translation="MSTSADTHPPSTSNQHTSKKLVILSLASLLVAILLAAFGYGLSTE
FT                   NTNTNITAKLFGLRRLFGTQSAAAAAVKRDISTSSAIPKSGSTMKTPVYFLSHGGPNIM
FT                   YEQDHPAYRKLSEIGREITTKVKPRAVVVFSAHWQAGRDTIQVNTAEMTDLIYDFYGFP
FT                   SHYYKEKFPNVGSKEIANKVLSALKEAGIKAEGVKRGLDHGVWASFKCVQVSLFNTEDP
FT                   AQHYRLGQAVSKLRDDNILIIVSGMAVHNLRDLQFTWGNPKPMPYTTSFDEALKDAVTK
FT                   PPAEREQAMSDLLKRPDARQAHPSFDHLLPIHIGAGAAGDDLGKRLWTLKEGSMSWAQY
FT                   RFGDVGNNSAL"
     atgtctacat ctgccgatac tcacccgccg agcacgagca accagcacac cagtaagaaa        60
     ctcgtgattc tttcactcgc ctctttgtta gtagcgatac tcctcgctgc gttcggatac       120
     gggctcagca ccgagaatac caataccaat atcaccgcca agctgttcgg gcttagacga       180
     ctctttggaa cgcagtcggc tgctgctgct gcagtgaaaa gagacatatc gacaagctct       240
     gctattccga agtccggcag cacgatgaag actcctgttt actttttgag tcatgggggt       300
     ccgaatatca tgtatgagca agaccacccg gcgtaccgta aattaagtga gatcgggcgc       360
     gagatcacca ccaaagtcaa gccacgggct gttgtggtat tctctgccca ctggcaggct       420
     ggtcgcgaca cgatccaagt gaatacggct gagatgactg atcttatata cgatttctac       480
     ggcttcccga gccactatta caaggagaag ttccccaacg tcgggagcaa ggagattgcg       540
     aacaaggtgc ttagtgcgtt gaaggaggcg ggcatcaaag cggagggagt caaaagaggt       600
     ttagatcatg gggtctgggc cagctttaaa tgcgtgcagg tgtcattgtt caacaccgag       660
     gatcctgccc agcactaccg actcggacaa gcggtgtcca agctgcgcga tgataatatc       720
     ctgatcattg tatcgggtat ggcagtccac aacctgcgtg atctgcagtt cacttggggc       780
     aaccccaagc caatgccgta cactacaagc tttgacgagg ctctgaagga cgctgtcacg       840
     aagccgcctg cggaaagaga gcaggctatg agtgacctcc tcaaacgacc cgatgcccgt       900
     caagcacatc cttcctttga tcatctgctg ccaattcata ttggagctgg cgctgcgggg       960
     gatgatcttg gaaaaagact ctggacgctg aaggagggaa gcatgagctg ggcgcagtat      1020
     agatttggtg atgtaggcaa taatagcgcg ctgtag                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page