(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE187

ASFUM1_6.PE187       Location/Qualifiers
FT   CDS_pept        join(complement(624608..624698),complement(624214..624493),
FT                   complement(624036..624109),complement(623043..623980),
FT                   complement(622898..622989),complement(622556..622842),
FT                   complement(622125..622504))
FT                   /codon_start=1
FT                   /gene_family="HOG000217793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263281"
FT                   /orf_name="AFUA_6G03010"
FT                   /product="C2H2 finger domain protein (Zms1), putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85737.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056292"
FT                   /db_xref="HOGENOM:HBG325064"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000F51CE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD01"
FT                   /transl_table=1
FT                   /translation="MKPDSDKHFRCTICQRGFTRIDHLKRHHLRHSGIKPYSCIFCNDS
FT                   FARWYAALFVIFSQNEMCQLRSPLGTFCCSAHRASTLTFARDHAAATTFVTTTPIARKG
FT                   GIGRSLIRDSEGEGDMLANRSCQKRGIECNNERKKQVSNQGTGSDALAAKREDYEQSSD
FT                   RGSIKFLLNGGTDSFTQQFLLPPRSDRTRSLEYHNKKSLEDAGSSILGYELKDSRTDYA
FT                   PTFIESDAATLSFFQDTFIDFFNGPFGDPHKLLDDPYVGQVAYHAVVPPGQDPNLTLTG
FT                   QQLSYEPERPFATGMIQAILARAWSVPLDAKAQQELSTNLNFLLTTSRIRKFVAMYFKY
FT                   WQPSCAMLHRTSFDPEIVSLPLLTAVTFMGAMYTNDEREAYIAKRVLDFAELFIFSSEV
FT                   YASETEISSMFCGNRCLDDESSDWIQFQNFQAGFIIVVVQYWAGSRISRNRVMENRFSE
FT                   VIKVARRIGLMKCRHMPHDPMDECSWIQKECRIRTMNIISLLDCAFSFYSNYPCRISHT
FT                   EMEWDFPCQEVIFDSQHPFVEPNFRFSRDIPISAGFNNLFETPISEDGSQAHVPDHIAD
FT                   MTVLDMFILIHLLYAFINTHMTLLAPLVHKTPLPNSRIPQGLSTPSKPPQSAIPEDSTL
FT                   AGIRTALSRWRDHWLALRNTVSSHEWASMGFYKNGYNFWLVSQLLITKKKSVDVVMQME
FT                   VKCEDKLEKLKVLLQDEND"
     atgaagcctg attccgacaa acattttcgt tgcacaatct gtcagcgagg ttttacgcgc        60
     attgatcatt tgaaaaggca tcatcttcgc cattctggta tcaaacctta ctcttgtatc       120
     ttctgcaatg actcgtttgc tcgttggtat gctgcgcttt tcgtgatttt ctcacaaaat       180
     gaaatgtgcc aattgcgctc gccgcttggt accttttgct gttctgctca ccgtgcctcg       240
     acgctaacat ttgcccgtga ccatgctgca gcgacaacct tcgtgaccac tactccgatt       300
     gcccgaaaag gggggatcgg cagatccctg atacgggaca gcgagggaga aggcgacatg       360
     cttgccaatc gctcttgtca gaaacgagga atcgaatgta ataacgagcg aaagaagcaa       420
     gtctcgaacc aagggactgg ttcagacgcc ttggcagcga aacgtgaaga ctacgagcaa       480
     tcgtcagatc gtggatcgat caaatttctt ctcaatggcg gtaccgatag tttcacgcag       540
     caattcctcc ttccaccccg cagcgatcga acacgcagcc tggaatatca caacaagaaa       600
     agtctcgaag acgcagggag ttccattctc ggatatgagt tgaaagatag ccggacagat       660
     tatgcgccca cattcatcga gtccgacgct gctaccttga gcttcttcca agatactttc       720
     attgactttt tcaacgggcc ctttggcgat cctcacaagc tactggacga cccctatgtc       780
     gggcaggttg cctaccatgc tgtcgttccg cccggacagg atcccaacct gacactcacg       840
     gggcaacagc ttagctacga acctgaacgg cccttcgcca ccggaatgat acaggctatt       900
     ctcgcaaggg cctggtccgt gccccttgac gcgaaggctc aacaagagct gtcgacgaat       960
     cttaatttcc ttctgacgac aagccgtatt cgcaagtttg tggcaatgta ctttaagtac      1020
     tggcaaccga gctgtgcgat gcttcatcgc acgtcgttcg atcctgagat tgtgtcatta      1080
     ccgctactta cagccgtcac attcatgggt gccatgtaca ccaatgacga gagggaggca      1140
     tatattgcca agcgagtgct ggatttcgcc gagctcttca tcttctccag cgaggtttat      1200
     gcgtccgaga ccgagatcag ctcgatgttt tgcgggaatc gatgtttgga cgacgagtcc      1260
     agcgactgga ttcagtttca gaatttccaa gccggcttca tcattgtggt tgtgcaatac      1320
     tgggctggaa gtcgcatatc gcgcaataga gtaatggaga acaggttcag cgaagtcatc      1380
     aaggtcgctc gtcgaatcgg actcatgaaa tgccgtcata tgccccatga tccgatggac      1440
     gagtgctctt ggatccagaa ggaatgccgc attcgaacca tgaacatcat atcacttctc      1500
     gactgtgcct tctcatttta ttcaaactac ccctgtcgta tatcccacac agaaatggaa      1560
     tgggactttc cgtgccaaga ggtgatcttc gactcgcagc atccctttgt ggagccgaat      1620
     ttccgattct cgcgggatat tcccatctcc gcaggcttta ataatctgtt tgaaaccccg      1680
     atcagcgagg atggttcaca agcccatgtt ccggatcata ttgccgatat gaccgtcctg      1740
     gatatgttta ttctcattca tttactgtat gccttcataa atacacacat gaccctcctg      1800
     gctcccttgg tacacaaaac accgttgcct aattcaagaa taccacaagg gctctcaacg      1860
     ccctcaaaac cccctcaaag tgcgattccg gaagactcca cattagccgg tatccgaaca      1920
     gcgctgtcgc gatggcgcga tcattggttg gcgctccgaa atacagtctc cagccacgaa      1980
     tgggcgtcca tgggcttcta caaaaacggc tacaactttt ggcttgtgtc gcagctcctc      2040
     atcaccaaga agaagagtgt ggatgtggtg atgcagatgg aggtgaagtg cgaggataaa      2100
     ctggagaagc tcaaggtctt gctccaggat gagaacgatt ga                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page