(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE189

ASFUM1_6.PE189       Location/Qualifiers
FT   CDS_pept        629031..629639
FT                   /codon_start=1
FT                   /gene_family="HOG000217794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750836"
FT                   /orf_name="AFUA_6G03025"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27240.1"
FT                   /db_xref="UniParc:UPI0000F51CCA"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA22"
FT                   /transl_table=1
FT                   /translation="MHSTSSSEGTSSGQSTLQIHIDELSSLPLHDTIQSLVHLLPELTT
FT                   SITPTGERLVTHPTYEGTGKLDDLGALYLRAADRCTRERASFKTRLLHISLDSMIEALY
FT                   ASSQEQLDKGLEDGTVHLPPRLDGGCACCNGEPFAVILSGFHEGNALLFWEDEYKAFWG
FT                   EEESLGGRYGLGETWIRASKEQVERAMAREEVNVNPSMP"
     atgcattcga cttcgagttc cgagggaacc agctcaggcc aatccaccct gcaaatccac        60
     atcgacgaac tctcctccct gcccctccac gacaccatcc aaagcttggt acacctcctc       120
     cccgaactaa ccacttctat cacgccaaca ggcgaacgcc tcgtgacgca ccctacctac       180
     gaaggaacag gcaagctcga cgatctgggt gcactctacc tccgcgcggc agatcgctgt       240
     acccgcgaac gcgcatcctt caaaacccgt ctcctgcata tatctcttga ttccatgatc       300
     gaagcactct acgcatcgag tcaagagcag ctcgataagg ggttggaaga tggaactgtg       360
     catctacctc ctaggctaga cggggggtgt gcgtgttgca acggcgagcc gtttgccgtg       420
     atcctgagcg ggtttcatga gggaaatgca ttacttttct gggaagatga atataaggct       480
     ttctgggggg aggaggagag cctaggggga cgatatggtc tcggcgagac ttggatcagg       540
     gcttcgaaag agcaagttga gcgtgcgatg gcgcgggaag aggtgaacgt taatcccagt       600
     atgccttag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page