(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE197

ASFUM1_6.PE197       Location/Qualifiers
FT   CDS_pept        join(complement(656096..656110),complement(655260..656011),
FT                   complement(655059..655212))
FT                   /codon_start=1
FT                   /gene_family="HOG000201883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264285"
FT                   /orf_name="AFUA_6G03100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85728.1"
FT                   /db_xref="HOGENOM:HBG056290"
FT                   /db_xref="HOGENOM:HBG331515"
FT                   /db_xref="UniParc:UPI000051F415"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD10"
FT                   /transl_table=1
FT                   /translation="MPPPPIYQLNPKQEQDTMALTNIPHINLLCMEERFIDAFQRALAQ
FT                   HWPETNTTPKPTITILNTSLRQVPSSTKFDLIVSPANSYGRLDGAFDDAISRVFCQPPK
FT                   HEYNTLTEATQKVLYKQWRGFAPPGTCTLVPFPDELIGENGWGCRWVAICPTMRYPDRV
FT                   TWDREIVYECVWSLLCQVEGWNRGCKKEKRIESILITPLATGVGKVSAAKWAAQFVLAM
FT                   RHFVDALRRPQRWAALSWGDLTAEVEEVKTTWELKRDGGILGQMWPELDASWYPNSRTV
FT                   MDIFERLMDIPWLPEFMIRKKSSDK"
     atgccccccc cccctattta tcaactcaat cccaaacaag agcaagacac gatggccctc        60
     acaaacatcc cacacatcaa cctcctctgc atggaagagc gcttcatcga cgccttccaa       120
     cgtgctctgg cccaacactg gccggaaacc aacaccaccc ccaaacccac catcaccatc       180
     ctcaatacct ccctccgcca agtcccatcc agcacaaagt tcgacctcat cgtctcacca       240
     gcaaactcct acggccgact cgatggcgcc tttgatgacg ccatatcccg cgttttctgc       300
     cagcccccaa agcacgaata caacactctc accgaggcaa cgcagaaagt cctctacaag       360
     cagtggaggg gtttcgcgcc cccagggaca tgtaccctcg tcccctttcc ggatgaacta       420
     atcggggaaa acggatgggg ctgtcgctgg gtggcgattt gccccaccat gcggtacccg       480
     gatcgggtca cttgggaccg cgagatcgtg tatgagtgtg tgtggagtct gttgtgccag       540
     gtcgaggggt ggaatcgcgg ctgcaagaaa gagaagcgga ttgagtccat tctgattacc       600
     ccactggcga cgggggtggg aaaggtgagt gcggcaaagt gggcggcgca gtttgtgctg       660
     gcgatgaggc attttgtgga cgctttgagg aggccccaga gatgggctgc tttgagctgg       720
     ggcgatttga cggcggaggt ggaggaggtc aagacaacgt gggaattaaa gagagacggg       780
     ggcatactcg gccaaatgtg gccggaactg gatgcatcat ggtatccaaa ttcaaggact       840
     gtaatggata tatttgaaag attaatggac attccctggc tgccggaatt tatgatcagg       900
     aagaagagct cggacaaata a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page