(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE198

ASFUM1_6.PE198       Location/Qualifiers
FT   CDS_pept        join(656256..656305,656362..657259,657307..658296)
FT                   /codon_start=1
FT                   /gene_family="HOG000199911" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903116"
FT                   /orf_name="AFUA_6G03110"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85727.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056289"
FT                   /db_xref="HOGENOM:HBG328707"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051FB54"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD11"
FT                   /transl_table=1
FT                   /translation="MWPPLHLAKRCNKLKVRRLTTHHVCMALSGISTRVIPRNVTMDHV
FT                   RRYNVERSCLRCHQRKVRCDKGSPCAACVRMKVPCQYPGPNRVQRRPPKASSADVVSRI
FT                   DQLERAVTELIRRPSTASPIHDNEVNVTRAAAPERQLRQGLLVRDGRYIDEHLLSGFLE
FT                   KDQELQTAIGTPRSAGKSPGRQSPLRVEGLITNSLREHVDFQALQPSRWQAIQLWQTFL
FT                   GRVDPVVKILHIPSTQPRVFAAINQRGDALADTQALLFAICFAATTALHSDDPSREEIC
FT                   SDIRRYQQGFELALYRSSFLDTPTLISLQAMAIYQTCLRYHNSGRSNWTLHGLTTRAAQ
FT                   SIGLHRDGRHFNLSPLECELRRRLWWHIVTCDQRAAEDHGLSIIAHNEPCDTNLPSNLD
FT                   DQDLSATATVPPAPQPRWTEMTFPLLTIQINRHLHEISRKTSQGVSPDPLVRELKDYIQ
FT                   RNYLQYGDANIPIQQQGLVLADVLTTKVAVYVRQKALQIHSQGQSQCPPQESATAQETL
FT                   AMACHGLERALELQTNDLLRGFRWLTATYTQYHLLCYILWHLCVYPASVHVERAWRSVE
FT                   AIFEVVERDPTWPDPGPKWAVMSQLRAKAMRAREGLTNRQADVQEKGPENVLDWGNWDL
FT                   ELFGFGEWTI"
     atgtggcccc ctctccactt ggccaagaga tgcaataagc ttaaggtaag acgactgacg        60
     acgcatcatg tgtgcatggc actgtcaggc atctcaactc gagtcattcc tcgaaatgtt       120
     accatggacc atgtccggcg gtataacgtc gagcgatctt gtctccgctg ccatcagcgc       180
     aaggtccgct gcgacaaggg ttccccctgt gcggcctgtg tccgcatgaa agtcccctgc       240
     cagtatccag gccctaatcg agtccaacgc cggccgccaa aagcgtcttc ggcagatgta       300
     gtctctcgga tagatcaatt ggagagagcc gtgacggagc tgattcggcg gccgtccact       360
     gccagtccaa tacacgacaa cgaggtcaat gtgacacgag ccgctgctcc tgagcgtcag       420
     cttcggcagg gtctgctggt gcgagacggt cggtatattg acgaacacct gctgtctggg       480
     ttccttgaga aagaccagga actgcaaacc gctattggca cgcctcggtc tgctggaaag       540
     agccctggac gacagtctcc tctgcgggtg gagggcctca ttaccaactc actgcgcgaa       600
     cacgtagatt tccaggccct gcagcctagt cgatggcaag ccatccagct ctggcagacc       660
     tttcttggtc gtgtcgatcc agtggtgaag attcttcata ttccgtcgac gcagccacgg       720
     gtctttgcgg ccatcaacca gcgtggggat gcgcttgcag atacccaggc gctcctgttc       780
     gccatttgct ttgcagccac aaccgcttta cactcggatg acccctcgcg ggaggaaatc       840
     tgctcggata ttcgccggta tcagcagggg ttcgagcttg ccctctatcg ctcttcgttc       900
     ctggacacac caactctgat ctcgctgcaa gccatggcca tctaccagac atgtctccgg       960
     tatcacaaca gcggccgctc caactggaca cttcacggcc tcaccactcg cgccgcccaa      1020
     tccatcggcc ttcatcgcga cggacggcac ttcaatctct cgccactgga atgcgaactc      1080
     cgccgccgac tgtggtggca cattgtgacg tgcgaccaac gcgccgcgga ggatcacggc      1140
     ctctccatca tcgcgcacaa tgaaccttgc gacacgaacc tgccgtccaa cctcgacgac      1200
     caggatctct ccgcaacggc gacagttccc ccggcacctc agccgcgctg gacggagatg      1260
     actttccccc tgcttacgat ccaaatcaac cgccatttgc atgagatctc acgaaagacc      1320
     tcgcagggtg tctcgccaga tccgctcgtt agggaactca aggactacat tcagcggaat      1380
     tacctgcaat acggggacgc caatattccg atccaacagc agggccttgt tctcgcagac      1440
     gtcctcacca cgaaagtcgc agtctacgtg aggcagaaag cactacagat tcacagccag      1500
     ggccagagcc agtgcccacc gcaggaaagt gcgacggcgc aggagacgct ggcgatggct      1560
     tgccatggcc ttgaacgtgc actggaactg cagacgaacg acctgctccg tggcttccgc      1620
     tggcttaccg ccacgtacac ccagtatcac ctcctgtgtt acatcctgtg gcatctgtgt      1680
     gtgtatccag cgagcgtaca tgttgagcgg gcatggcgca gcgtcgaggc gatctttgag      1740
     gtggtggaaa gggatcccac gtggcctgac ccggggccca aatgggcggt tatgtcccaa      1800
     ttgagagcca aggcgatgag agcgagggaa ggattgacca atcggcaggc cgatgtgcag      1860
     gaaaagggac cagagaatgt cttggactgg gggaattggg atctggagtt gttcgggttt      1920
     ggggagtgga ctatttga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page