(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE2

ASFUM1_6.PE2         Location/Qualifiers
FT   CDS_pept        join(34609..35939,35995..36790)
FT                   /codon_start=1
FT                   /gene_family="HOG000234843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262204"
FT                   /orf_name="AFUA_6G00120"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84255.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056571"
FT                   /db_xref="HOGENOM:HBG326056"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EB23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8W4"
FT                   /transl_table=1
FT                   /translation="MSRRSLGTTTPPSHPPASLPRSESPRASVTKRPLNTTNKSGDDEN
FT                   RRKDPKVSRACDTCKKKKIRCDGTIPCTNCTKRKVSCAYDMKYGRGRPPTPPSSAAIRE
FT                   HQNRLRSNYSYDLSNWQPPVSVAPEISSPLVHSRASPTGEIEGQYFDPTSGLNFLHRAW
FT                   KKLLTTQNDQPASYRLSVSEQNQLLTSAGDRPFHIESDALDSFIPDASTARKLQQFYFE
FT                   TCVVTYRMFHRPSVEGWMEIFLKDGQGAGPTARSLGKAKTATLLTIMAIANLRLHRVSG
FT                   ETSTEAESLALKRSDHLFCAGMRMTEEEIGFPRLESAQARLVQVLYLLQTSRINKAWYT
FT                   FGNAFQITLSLGMHRRRDQKRDYPFTSRRQDYITSECYKRTFWVAYTVDRYLSVVLGRP
FT                   RLYQDEDIDQNFPDTVNDEDMTPDGFSISDDPADCYIDALIYHAKIAQIIGKISREVYS
FT                   VSELYSQNRLAAAHRLGRELHEWRESLPPHLGTVKPTTLIPSFRRQAIALQLAYFHAII
FT                   HAYRPFLLSDAASEIVSECILATKACLELINKVARDSMLFHSFWWTHYVIFCALAVVYV
FT                   WEIQRTTRSLVETVDTSLGKIFELAEKCHGHLKRASTGLSQNQRYSVILDELRSEAQRC
FT                   RSLTTNPPKIDQEGACGGEASANANNGFRLLQDPNMFGTGLEAILPEGVMLNMPDSFLF
FT                   NDWQTLDSSVCISV"
     atgtcgcgcc gatcgcttgg aacaaccaca ccacccagtc acccgccagc atctctcccc        60
     agatcagagt caccaagagc ttctgtaact aagcgccccc taaacacgac gaataaaagt       120
     ggggatgatg agaaccgtcg gaaagacccg aaggttagta gggcttgtga cacctgcaag       180
     aagaagaaaa tacgatgcga cggtacaatt ccgtgtacca actgtaccaa gaggaaggtc       240
     agttgcgcgt atgacatgaa gtatggccga gggcgacccc cgacacctcc atcttcagcc       300
     gcgattcgcg aacatcaaaa caggctgaga agtaattact catatgatct ctctaactgg       360
     cagccaccag tctccgtcgc tcctgaaata tcgtcgccac tagtccattc tcgagcctca       420
     ccaactggtg aaattgaggg tcaatatttt gatcctacct cgggattgaa ctttttacac       480
     cgagcatgga aaaagctttt gaccacccag aatgatcaac cggcatcata ccgcctaagc       540
     gtttcggagc agaatcagct ccttacatca gcaggtgacc gaccctttca cattgagagc       600
     gatgcattgg acagcttcat tcctgatgcc tcaacagcga gaaagctgca gcaattctac       660
     ttcgagacgt gtgtggtcac ataccgcatg ttccatcgac cgagtgtgga aggctggatg       720
     gagatctttc tgaaagatgg acaaggcgca gggcccactg ctcggtctct tggtaaggcc       780
     aaaactgcga ctctccttac catcatggct atcgcgaacc tgcgcctgca cagggtgagc       840
     ggggagacat caacggaggc tgagtcgctt gccttgaaac ggagcgatca cttgttttgt       900
     gctggtatga gaatgactga agaggagatt gggtttccgc gtcttgaatc agcacaggca       960
     cgtctggtcc aagtcctcta ccttcttcaa acctcccgta taaataaagc ctggtacaca      1020
     tttggcaatg cgttccaaat cacactctcg ctgggtatgc acaggaggcg ggaccagaag      1080
     agggattacc ccttcacaag caggaggcag gattatatca cgtcagagtg ctataagcgc      1140
     accttttggg tggcatatac tgtcgacaga tatctgagtg ttgtgcttgg tcggcctcga      1200
     ctttaccagg atgaagacat cgaccagaat tttccagata ctgtaaacga tgaggacatg      1260
     acaccggatg ggttttccat ttcagatgac ccggctgatt gttatatcga tgctctcata      1320
     tatcatgcga aaattgctca aatcatcggg aagatatcac gggaagtgta ctcagttagc      1380
     gagctgtata gccagaatcg cttggctgct gcccatcggt tgggccgcga attacatgaa      1440
     tggcgtgaaa gcctgccacc acacttaggt actgttaagc caacaacatt aatacctagt      1500
     tttcggcgtc aggctattgc cttgcagctc gcatatttcc atgccatcat tcatgcctat      1560
     cgaccctttc ttttgagcga cgcagcatct gagattgtca gtgaatgtat cttagccacc      1620
     aaggcctgtc tagagcttat taacaaagtg gcgagagaca gcatgctgtt tcattccttc      1680
     tggtggactc attatgtgat cttctgtgca ttggctgtgg tttatgtttg ggagattcaa      1740
     cgaactactc gatccctcgt tgaaactgtc gatacgtctc tgggcaaaat atttgagctt      1800
     gcggagaaat gccatggtca tctcaagcga gcatctactg gtctatcgca aaaccaacga      1860
     tacagcgtca tactcgacga actgagatct gaagcacaaa gatgtcgatc tctgaccaca      1920
     aacccgccaa agatagatca agagggtgct tgtggcggcg aagccagcgc caatgcaaat      1980
     aatggctttc gtttgttgca ggatccgaat atgttcggga ctggtttaga agccatactt      2040
     ccagaaggtg tcatgttgaa tatgccggac agcttcttgt tcaatgactg gcagactctt      2100
     gactcatcgg tatgtataag cgtatga                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page