(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE200

ASFUM1_6.PE200       Location/Qualifiers
FT   CDS_pept        join(complement(664259..664367),complement(663878..664215))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264286"
FT                   /orf_name="AFUA_6G03130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85725.1"
FT                   /db_xref="HOGENOM:HBG056287"
FT                   /db_xref="UniParc:UPI000051E5B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD13"
FT                   /transl_table=1
FT                   /translation="MKHVAIPHVILGAIHQLSNISLFGGNPAIDLVDNDVENTRRISSP
FT                   PVTVTWSVCTVKVACGAKWATMASTSRSSTALKKLAGRDASRSRVRVMFGGLDVQIGKS
FT                   VITVGEFQMKIAVWIKWQIVKISGGLVPVLGKFNQQSAKVRYYQ"
     atgaaacacg ttgcaattcc gcatgtcatt ctgggtgcca tccatcaact ctccaacata        60
     agtctgttcg gtggaaaccc tgcgattgac ctcgtcgaca acgatgttga aaacacgagg       120
     cggatctcgt cgcccccggt gactgtgaca tggtcggttt gcacggtgaa agtggcatgc       180
     ggcgcaaagt gggcgactat ggcgtcgaca tctcggtcgt cgacggctct aaagaagctg       240
     gccggtaggg acgccagccg gtctcgggtc agggtcatgt ttggtggact ggatgtgcag       300
     attggcaaga gcgtgatcac agttggagag ttccagatga aaattgctgt gtggattaag       360
     tggcagatcg tcaagatcag tggagggctt gtcccggtcc ttggcaagtt taaccagcaa       420
     tcggctaaag ttagatatta ccagtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page