(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE208

ASFUM1_6.PE208       Location/Qualifiers
FT   CDS_pept        683854..684132
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264289"
FT                   /orf_name="AFUA_6G03220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85717.1"
FT                   /db_xref="HOGENOM:HBG056281"
FT                   /db_xref="UniParc:UPI000051F8CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD21"
FT                   /transl_table=1
FT                   /translation="MPSQPAYFQLDQFSIMPFDGFSFKLQLAAHRCLAVCRDKETAKHV
FT                   ITRYGLAAWGAVVSLWLPEAIIWAVFGEEGKLKSPSDRLLLGLSSHR"
     atgccctctc aacctgcata cttccagttg gaccagttct caatcatgcc attcgacgga        60
     ttctccttca agttgcaact tgctgcccat cgatgcctcg ctgtctgcag agacaaggag       120
     acagcgaagc acgtgataac ccgatacgga ctagcggctt ggggagcagt ggtgtcctta       180
     tggttgcctg aggccatcat atgggccgta ttcggagagg agggaaaatt gaagagtccc       240
     tctgatcgcc ttctccttgg gctttccagt cacagatag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page