(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE211

ASFUM1_6.PE211       Location/Qualifiers
FT   CDS_pept        join(688416..689611,689656..690576,690620..692348)
FT                   /codon_start=1
FT                   /gene_family="HOG000201794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264291"
FT                   /orf_name="AFUA_6G03252"
FT                   /product="Protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85713.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG056277"
FT                   /db_xref="HOGENOM:HBG325062"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000F51CCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD25"
FT                   /transl_table=1
FT                   /translation="MTGLSSYDEILNSLEEDSYYAVSSNDLSPSLQAWSNNTDLEELDL
FT                   SSLNLSSSSDSSSWIDPLESAITDTRNGSSPVLSTLSQFTALLAQTGIHGPRILKAFNL
FT                   SRRGTKIGAGAQFTVFTDPIYEGQVIKRVNVPLSSKAEQRFAASTDYRLQLRTLGLEVL
FT                   SLCNPMLRAHPNITSLLAWGFDFPFADMAVPVLFMEAAMMPLSDFLGAETRAVEVRYQL
FT                   SLDVANGLEALQNLNIVHGDVKPENVLVFAGPSDRVPFRAKLSDFGVCLDLEAPDAKFM
FT                   LSDYRGTQAWLAPEVVSEDLDRFGGFSSELMFRFDAYSFGLVLLSVFTGNGAAPVLDEH
FT                   PENVPDQVFELLYGQEDIPSNIRIELRKAIAKLLSEDPRKRPLPSPGLIKTDSPTYAAW
FT                   LSSIQLTPTNTHAGIMDPIYNKGPLFWYRLDESIRTELEGQYALMQEGNAPPFPGDVLF
FT                   GLAQTITGAKPSYLDRLLTYLTEAARAGYSPARGVYAQIMEAHGQKPEFAEDVLGEWML
FT                   QAVSEGYFFASPSYSKGRIEEARERFRANGGFCSDPFLAKKDVVEAAGDRTKALRRTME
FT                   NGSVVDRKGNTILHAAAALGAIDAVRGLLDDGQLPVNVENEKGETPLYKACQAGHAKIV
FT                   ELLLDRGADASTMTRQDKLSPMHWLFMISDASIPEIARRMVEGGADINATIEPVVKENS
FT                   AGFPEKIQILHYPFELPHGTPLHWACFFRNLTAVEALISLGANINASYHASDASTTPLF
FT                   LTAYFGEPSLAKYLISHGADVHLVDSMGRNALHGITKYFPERHGYLPHHWHYWIRHGSW
FT                   EHHLTQMTELVKILVDAGADLNANDKGYPPLTPVAAAADLGVWDGGVICALLDAGADLG
FT                   ESVLSAGNTVLHSWASIVGPRLAYPDSYLSTMKKIVSATPDIDIPNKFEKDTPLHLLAT
FT                   TYHPEEEFEAACEMFLAHSPPADINAKTRRGATPLTIALETDLDPVRRGLFLLHKGADT
FT                   LVLNARGRDIFFSIVNNAALTDQATHDLIRTFLQHRNPDIQQAYAKHYLPNSNSYHTLF
FT                   AAAERGKPLSLALLLSLGLSSRINDLEGSKRPPWTVLDQALHGAEISRRAHMRRLADHK
FT                   PGAHRNRALEQDIVYDEAQGPPARAAEAYRGFPAVIRILRDAGGKRACELDGSSTATGE
FT                   YIEQPWEWDLTEIYSYGFTPKTQPNLEQWSGLYEEARYSEQWQKGRLNAWKEEYEEGRW
FT                   RPDVRMLEEEEQSFVNELVCCLAGEGRVTLEAVDGQKKQWQVEMEGGKIVKKQGKK"
     atgactggcc tatcttccta cgacgaaatt ctcaattccc tagaggagga cagctactac        60
     gccgtcagca gcaacgatct ctctccctct ctccaagcat ggtccaacaa cacagacctg       120
     gaggaactcg acctcagcag cctcaacctc tcttctagct cagactcatc ctcatggatc       180
     gaccctttag agtcggcaat aacagacacc cgcaacggct cctcgcccgt cctcagcacc       240
     ctttcgcagt tcacagccct cctcgcccaa accggaatcc acggcccccg catcctcaaa       300
     gccttcaatc tctccagacg aggtacgaaa attggcgcag gcgcccagtt caccgttttc       360
     accgacccca tctacgaagg ccaggttatc aagcgcgtca atgtcccact ctccagtaag       420
     gccgagcagc gcttcgccgc gagcacggac taccgcctgc agctgcgcac gctggggctg       480
     gaggttttat cgctgtgtaa tccgatgctg cgcgcgcatc ccaacatcac cagtctgctg       540
     gcgtggggat tcgatttccc ctttgcggat atggcggtgc cggtgctgtt catggaggct       600
     gcgatgatgc ccttatccga ttttctgggc gcggagacgc gtgccgtgga ggtgcggtat       660
     cagctctcgc tcgatgtcgc gaatgggcta gaggcactgc agaacttgaa tatcgtgcat       720
     ggggacgtga agccggagaa tgtgcttgtg tttgcgggtc cgagcgatcg ggtgcccttc       780
     cgggcgaagt tgagtgattt tggggtctgc ctggatctgg aggcgccgga tgcgaagttc       840
     atgttgagtg attaccgggg cacgcaggcg tggctggcgc ccgaggtggt gagtgaggat       900
     ctcgataggt tcggggggtt ttcctcagag ttgatgttca ggttcgatgc gtatagcttt       960
     gggctggtgc tgctgtctgt ctttacgggg aacggcgcgg ccccggttct ggatgagcat      1020
     ccagagaatg ttcctgatca ggtttttgaa ttgctttatg gtcaggagga cattccgtcg      1080
     aacatccgca tcgagctgcg gaaagcgata gcaaagcttc tgtcagaaga tccacggaaa      1140
     cggccacttc ccagtccagg cttgatcaaa actgatagcc ctacgtacgc agcttggctc      1200
     tcctccatcc aattgacacc tacaaacacg cacgccggca tcatggatcc aatttacaac      1260
     aaaggtccct tgttctggta ccgactcgat gaaagcattc ggacagagct ggaagggcaa      1320
     tacgccctga tgcaagaggg aaacgcaccg ccattccccg gtgacgtgct ctttgggctg      1380
     gcacagacga ttaccggcgc caagccgtcg tatctcgacc ggctgctgac gtatctaacc      1440
     gaggcagcca gagcaggata ctcgcctgca aggggggtat atgcccagat catggaggcg      1500
     catggccaga agccggagtt tgcggaggat gtgctggggg agtggatgtt gcaggctgtt      1560
     tccgaggggt atttctttgc gagtcccagt tactcgaagg ggaggatcga ggaagcgcgt      1620
     gaacggttca gggccaatgg agggttctgt tcagatccat ttctcgcgaa gaaggatgtt      1680
     gtcgaggctg cgggggaccg gaccaaagcg ctgaggcgga cgatggagaa tggaagtgtt      1740
     gtcgatcgga aaggaaacac gatcctacat gctgcggctg cattgggagc tattgacgcc      1800
     gttcgaggac tactagacga cgggcagctg cccgtcaatg tggagaatga aaagggagaa      1860
     acaccactgt acaaggcatg ccaagctggc catgcaaaaa tcgttgaatt attgcttgac      1920
     cggggggctg atgcttcgac tatgactcgg caggacaagt tgagtccgat gcactggctg      1980
     tttatgattt ctgacgcttc tatccctgaa atcgcgagac gaatggtcga gggaggcgcg      2040
     gacatcaacg ccaccattga gcctgttgta aaggagaaca gtgctggatt ccctgagaag      2100
     attcagatcc ttcactatcc ctttgagctt ccccacggta cacctctgca ctgggcttgt      2160
     ttcttccgca acctgactgc ggtcgaagcc ctgatttctc tcggtgccaa tatcaacgca      2220
     agctatcatg cctcggatgc atccaccact cctcttttct tgaccgcgta ctttggtgaa      2280
     ccctctcttg ccaaatacct gatctcccac ggggccgatg tccacctggt cgactccatg      2340
     gggcgcaacg cgctgcacgg aatcaccaag tacttccccg agcgacatgg ctatcttccg      2400
     caccactggc actactggat ccgtcatggc agctgggagc accacctgac tcaaatgacg      2460
     gagttagtca agatactggt ggacgcaggc gcggacctca atgctaacga caagggatat      2520
     ccaccactaa cccccgtcgc ggcggctgcg gaccttggcg tctgggacgg aggagtgatt      2580
     tgtgcactgt tagacgcagg ggcagactta ggtgaatccg tcctgtcagc tggaaacacg      2640
     gttctacatt cgtgggcatc tatagtggga ccccgtctcg cttatcccga ttcctacctg      2700
     tcgacgatga agaaaattgt cagcgccacg ccagatattg acatcccaaa caagtttgaa      2760
     aaggatactc cactacattt gttagccacc acttaccatc cagaagagga attcgaagcc      2820
     gcgtgcgaga tgttcctcgc ccactcccct ccagcagata tcaatgcaaa gacccgccgc      2880
     ggagcgactc cgctgaccat cgccctcgag acagatctcg acccggtacg acgaggcctc      2940
     tttctcctgc acaagggcgc cgacacgcta gttctcaatg cccggggaag ggacatcttc      3000
     ttctcgatcg tcaacaacgc cgcacttacc gaccaggcca cgcacgacct gatccgcaca      3060
     ttcctccaac accgcaaccc tgacattcag caagcctacg caaagcatta cctcccgaat      3120
     tccaacagct accataccct tttcgccgct gcagaacgcg gaaagccgct ctcgctagca      3180
     cttctcctct ccctgggcct gtccagtcgc atcaacgacc tcgagggcag taaacgccca      3240
     ccatggacag tcctcgatca agccctccac ggggccgaaa tcagccgccg cgcacacatg      3300
     cgtcgactgg cggaccacaa gcccggcgcc catcggaatc gagctcttga gcaggatatc      3360
     gtgtatgatg aagcgcaggg tccgcccgct cgagctgcgg aggcctatcg gggatttcct      3420
     gcggtgatac gcatcctaag ggacgcggga gggaaacgag catgcgagtt ggatggtagc      3480
     tcgacggcca ccggggagta tatcgagcaa ccgtgggagt gggatttgac cgaaatatat      3540
     agctatggat ttacgccgaa aacgcagccg aacttggaac agtggagtgg gctgtatgag      3600
     gaggcgcgat actcggagca atggcaaaag ggtaggctga atgcttggaa ggaggagtac      3660
     gaagagggaa gatggaggcc ggacgtcaga atgctggagg aagaggagca atcatttgta      3720
     aatgagttag tctgttgtct ggcaggagag gggagggtga cactggaggc tgtagacggc      3780
     cagaaaaagc aatggcaggt cgagatggaa gggggaaaga ttgtgaagaa acagggcaag      3840
     aaatga                                                                 3846
//

If you have problems or comments...

PBIL Back to PBIL home page