(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE213

ASFUM1_6.PE213       Location/Qualifiers
FT   CDS_pept        694435..695010
FT                   /codon_start=1
FT                   /gene_family="HOG000217800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056380"
FT                   /orf_name="AFUA_6G03270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85711.1"
FT                   /db_xref="HOGENOM:HBG056275"
FT                   /db_xref="UniParc:UPI000051FDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD27"
FT                   /transl_table=1
FT                   /translation="MLTHIQHLPLELREKLALLPESPSREEIYVLWTHLLQRYFPFRLH
FT                   GSLPNLADLPDETAVKYALGNHQESESSHIALAVGREYGPFDRLSFLHVFCQAETKEKW
FT                   HLAEMQDKLKEEMMKSSHCEIARRRGMTIHGAIVVSRQVEFYKMKRDGSFECMTWLAQE
FT                   KKRLHILRDMRTITSHLMQINYEVRLRD"
     atgctaactc atatccagca tctcccgctt gagctgcgcg agaaactcgc actcctcccc        60
     gagtctccct cgcgtgaaga gatctatgtc ctgtggacgc acctcctaca gaggtatttc       120
     cccttccgtc ttcatggctc cctccccaac ctggccgatc ttcctgacga gaccgcggtg       180
     aagtacgctc taggcaatca ccaggaatcc gagagctcac atatcgccct cgccgtcggc       240
     cgtgaatacg gtccgttcga ccgcctcagt ttccttcacg tcttctgcca ggcggagacg       300
     aaggaaaaat ggcacctggc agagatgcag gacaagttga aggaggagat gatgaagtcg       360
     tctcattgtg agattgcacg ccggcgcggg atgacgatcc acggtgcaat cgtcgtcagt       420
     cgtcaggttg agttctacaa gatgaagcgt gatggatcgt ttgaatgtat gacgtggttg       480
     gctcaggaga agaagcgtct gcatatcctc cgggatatgc ggactattac ctcccacctt       540
     atgcagataa actacgaggt gagactgcga gattga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page