(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE219

ASFUM1_6.PE219       Location/Qualifiers
FT   CDS_pept        join(709739..709898,709954..710441)
FT                   /codon_start=1
FT                   /gene_family="HOG000217802" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264294"
FT                   /orf_name="AFUA_6G03330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85705.1"
FT                   /db_xref="HOGENOM:HBG056271"
FT                   /db_xref="UniParc:UPI000051E824"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD33"
FT                   /transl_table=1
FT                   /translation="MSDTIITRADDLPEPKELAEAYELELQSQNGRSIRFGELVAGKGA
FT                   QITTIVIFIRHFFCAYDQDYVRVVSPRLTNFVLSTLPNPTGPSQLIIIGCGDSQRIVPY
FT                   VSETAAAFPIYTDRTGKIYKKLLMKRTTSHITQPPSYAQVSFFGALGKTFGQMFRSGWQ
FT                   AFRGGSWSQNGGEWVFRGGKSFYVHRMEHVSDHLTADRLLEVLSLDEPAQTK"
     atgagtgaca ctatcataac cagagctgac gacctcccag agccaaaaga gctcgccgaa        60
     gcctacgagc tcgaactgca atcccagaat ggccgatcga tccggttcgg cgagctagtt       120
     gcaggaaaag gagcccagat cacgacgatt gtgattttca tccgtcactt cttctgcgca       180
     tatgatcagg actacgttcg cgtggtctcg ccgcgtctca ctaacttcgt cctctcgacg       240
     ctccccaacc ccactggtcc atcacagctc atcatcatcg gctgtggtga ctcccaacgc       300
     atcgtccctt atgtatcgga gactgcagcc gcgttcccca tctacacgga ccgcacgggg       360
     aagatctaca agaagctgct catgaagagg acgacgtcac acatcactca accgccctct       420
     tatgcgcagg tctctttctt cggtgcgctt gggaagacat tcggacagat gtttcggagt       480
     gggtggcagg cttttcgagg ggggagctgg agccagaacg gcggcgagtg ggtgtttcga       540
     gggggcaaga gtttctatgt ccatcggatg gagcatgtct cggatcattt gaccgcggac       600
     cgattgcttg aagtgctcag ccttgatgag ccggctcaaa cgaagtag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page