(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE221

ASFUM1_6.PE221       Location/Qualifiers
FT   CDS_pept        712545..712883
FT                   /codon_start=1
FT                   /gene_family="HOG000253040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751076"
FT                   /orf_name="AFUA_6G03345"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27238.1"
FT                   /db_xref="UniParc:UPI0000F51CE1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA20"
FT                   /transl_table=1
FT                   /translation="MASKRGIFPLYANIHHGIISRQYGLRRCPQPIASFSSHFAVANKQ
FT                   SGPHKGQSQGNHPQNTEIPSFSFDSLGPAKTTKTVVLVILGVFGTIESWFWAQAIWRWW
FT                   KGDDEDAK"
     atggcctcca agcgtggcat ctttcctctc tatgcaaaca tccatcatgg aataatatcc        60
     cgccaatacg gactccgcag atgtcctcag cctattgcat ccttctcaag ccattttgcg       120
     gtcgcaaaca aacagagcgg gcctcacaaa ggccagtcgc aaggcaatca tccgcagaat       180
     acagaaatcc catccttcag tttcgactct ctcggtccgg ccaagactac aaagaccgtt       240
     gtcctcgtca ttctcggtgt ctttggtacc attgaaagct ggttctgggc ccaagcaatc       300
     tggcgctggt ggaagggcga cgatgaagat gcaaagtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page