(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE225

ASFUM1_6.PE225       Location/Qualifiers
FT   CDS_pept        join(721183..721281,721312..721374,721426..723321)
FT                   /codon_start=1
FT                   /gene_family="HOG000048642" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264298"
FT                   /orf_name="AFUA_6G03380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85700.2"
FT                   /db_xref="HOGENOM:HBG056268"
FT                   /db_xref="InterPro:IPR021514"
FT                   /db_xref="UniParc:UPI0000F51CCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD38"
FT                   /transl_table=1
FT                   /translation="MLAHSTTRWDLPNRVPRLLRRLKALADMSALIQPQQGKRQAPFSG
FT                   WKLEILACLGKPLPQWPFRVSINTLLSIYGGVMKAATIYVVGSCIGQLQWSWFSSERPL
FT                   IDLSRLADLSHGDLFGAFRWLGSNHIREPFITLGAIVAIASLAFEPFIQQLTSYGDCSV
FT                   PLKNLRVAPNIPRTNYIVQRSGVSSAQSGDPEIAQAILLGLVGGPNPLASTGCTAGNCT
FT                   FPTAYTSAGICSTCEDISSNITVTKTCRGENSSVVDCANATYQQSVVWADRITSASYGG
FT                   VELTNVSWTPMQNESLLFHVDTALYPQWPKFVMFGVVIVWGETTYSQAKVNPLTTEPLH
FT                   GCEDPSTNNTWACRGYGSAYCKLRFCTRTYNASVEAGILVENNIEESPSSTKELVSPPP
FT                   EALAGASAATLGLLDLRCINDVELRELRNVGYNISSASPRWAGYVVDHDLFQLDGNKYN
FT                   DIGPDSPFPQSLLAHRCLYMMSLRFQTNWFYVAGALSGNVSTGRIQSSRSTIGPKVLQN
FT                   IEPLSTLSGDGGPILLYSNSKVDFGSISAKLSNVATHMTTMVRQTGNVNHSAPAERVVF
FT                   HYATCLNVHWIWIILPSIAAGCVVALLAAVILLTAHGGTRIWKGNILALLFHGPGGAGW
FT                   SSMPVSGEDGDNVLSKLNTNQGMEQRAREIKVKLDQSSDSAQLLKAGEMK"
     atgctggccc actctaccac ccggtgggac ctcccgaatc gcgtgccccg acttttacgg        60
     agactgaaag ccctcgcgga catgtcggcg ctgatacagc cccagcaagg gaagcgccaa       120
     gccccattct caggatggaa gctggagatc ttagcatgtt tgggcaagcc gcttccccaa       180
     tggccctttc gagtgtctat caacacattg ctgtccatct acgggggagt gatgaaggca       240
     gccactatat atgtcgttgg atcttgcatc ggccagctcc agtggtcatg gttctcgtct       300
     gaacggcctc ttatcgacct ctctcggctt gcagacctat ctcatggaga tctgtttgga       360
     gcgttccgct ggctcgggtc aaatcatatc cgagagccgt tcatcaccct tggcgcaatc       420
     gtcgccatcg cgtctctcgc ctttgagcca tttatacagc agcttacctc gtatggcgac       480
     tgcagcgtcc cgctgaagaa cctccgggtt gctccgaata taccacggac gaactacatc       540
     gttcaaagga gtggtgtatc gtccgcccaa agtggtgacc cggaaattgc acaggccatc       600
     ttgttgggcc tcgttggcgg tcccaatcct ctggccagta ctggatgtac ggcaggaaac       660
     tgtaccttcc cgactgccta cacgagcgcc ggcatctgct cgacatgtga agacatttcc       720
     agcaacataa ctgtcacgaa gacctgcaga ggggagaata gctctgtcgt cgactgcgcc       780
     aacgcaacat accaacagag cgtggtttgg gccgatcgca tcacctcagc ctcatatggt       840
     ggtgtcgagt tgacgaatgt tagctggact ccgatgcaga atgaatccct gctctttcac       900
     gtggacactg cgctctatcc acaatggcca aaattcgtta tgtttggagt cgtgattgtc       960
     tggggagaga cgacgtactc gcaagcaaag gtcaaccctt taaccacgga gcctctgcac      1020
     ggttgcgagg acccgtcaac caacaataca tgggcttgca ggggctatgg gtcagcatac      1080
     tgcaagctgc ggttctgcac tcgcacatac aacgcatctg ttgaagctgg tattctagtg      1140
     gagaacaaca tcgaggaaag cccatcgtcg acgaaagaac tggtgtcccc gccgccagaa      1200
     gcactagcag gagcctccgc ggccaccctc ggtcttctcg atctccgttg tatcaacgac      1260
     gtggagcttc gggaacttcg caacgttggc tacaatattt cctcggcatc gccccggtgg      1320
     gccggatacg ttgtcgacca cgacctgttc cagcttgacg gcaacaagta caacgatatc      1380
     gggcccgatt caccattccc acaatcacta ttggctcaca gatgcctcta catgatgagc      1440
     cttaggttcc aaaccaattg gttctacgtc gcaggcgccc tcagcggaaa cgtctcaacc      1500
     ggcaggatcc agagcagccg ctccactatt ggccccaagg tgctgcaaaa cattgagcca      1560
     ttgtcaactc tgtccggtga tggcgggccg atcttactct acagcaactc caaggtcgac      1620
     tttggcagca tttccgccaa gctctccaac gtagccacgc acatgacgac aatggtgcgt      1680
     caaacgggaa acgtgaacca cagcgcaccg gccgagagag tagtcttcca ctatgcgacg      1740
     tgcctcaacg tccactggat ctggatcata ctcccatcca tcgcagccgg ctgtgtcgta      1800
     gcgttgctag ccgcagttat cctgttaacc gcccacggcg ggacgcgcat atggaaggga      1860
     aacatcctgg ctcttctatt ccatggtcca ggcggtgctg gttggagcag tatgcctgtg      1920
     tccggcgagg acggggacaa tgtgttgtcc aaactaaaca caaatcaagg aatggagcag      1980
     agagcacgag agatcaaggt taagcttgac cagtcttcag attcggcaca gctcttgaaa      2040
     gcaggagaga tgaaatag                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page