(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE226

ASFUM1_6.PE226       Location/Qualifiers
FT   CDS_pept        join(725580..725630,725725..725899,725969..726098,
FT                   726154..726199,726257..726586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056382"
FT                   /orf_name="AFUA_6G03390"
FT                   /product="Glutathione S-transferase family protein,
FT                   putative"
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="EAL85699.2"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG056267"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51CDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD39"
FT                   /transl_table=1
FT                   /translation="MASFYAAETPERVKKAQLTLTKGLHLITSLTPNGRKVHILLEELK
FT                   DTYGLEWMISLIDLDKNEQKKDWFLRLNPNGRIPILIDNNTCPPHVVMKSSAELLYLVN
FT                   LADKDNIFWFLDLIDKCNIIFLGIMRTKALTVASENCCRCTTYLKSVFQGDMVAAHGSI
FT                   WLGRVRANTALLISMPGPGCEIFDALDSRRMSWLRYLIYNSGWIALRRDQLWSEVWGSG
FT                   MMRMCIQSYCLRLRDYLLRCA"
     atggcttcgt tttatgccgc ggaaaccccc gaacgggtga agaaagccca actaactctc        60
     acaaagggcc tgcaccttat aacttctctg accccaaacg gaagaaaggt ccacattcta       120
     ctcgaagaac tcaaggacac ctacggcctt gaatggatga taagtctgat tgatctcgac       180
     aaaaatgaac agaaaaaaga ctggttcctc agactaaacc ctaatgggcg catcccaatc       240
     ttaattgaca acaatacatg tccgccccac gtagtcatga aatcatctgc tgaacttttg       300
     taccttgtta atttggcaga caaagacaat attttctggt ttttggatct gattgacaag       360
     tgcaatataa tttttctcgg aataatgcgg accaaagccc tcaccgttgc aagcgagaac       420
     tgctgcaggt gtacgacgta cttgaaatcc gtctttcagg gagatatggt ggcggcacac       480
     gggagtatct ggctgggcag ggtcagggca aatacagcat tgctgatatc aatgcctggg       540
     cctgggtgcg aaatattcga cgcattggac tctcggagaa tgagttggct ccgttacctc       600
     atttacaaca gtgggtggat cgcattgcgg cgcgaccagc tgtggagcga ggtttggggg       660
     agtggtatga tgaggatgtg catccagagt tattgcttga gactgcgtga ctacctgctg       720
     cgttgcgcat ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page