(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE227

ASFUM1_6.PE227       Location/Qualifiers
FT   CDS_pept        join(complement(729157..729251),complement(729078..729109),
FT                   complement(728865..729031))
FT                   /codon_start=1
FT                   /gene_family="HOG000201772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264299"
FT                   /orf_name="AFUA_6G03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85698.2"
FT                   /db_xref="HOGENOM:HBG056266"
FT                   /db_xref="HOGENOM:HBG325058"
FT                   /db_xref="UniParc:UPI0000F51CD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD40"
FT                   /transl_table=1
FT                   /translation="MSSFATPSPHSPRPFFKRPAYPSFKVGRVGKLYLPAMAVVAAGFG
FT                   IANYLNDFQAQQARYQLQEEERIRQNQKLMDAYGDKDSLHDVQHALEAYEIQ"
     atgtcctcct ttgctacacc ttccccacac tccccacggc cattcttcaa gagacccgcc        60
     taccccagct tcaaagtagg gagggtcgga aaactgtatc ttccagccat ggctgtcgtc       120
     gcagctggat tcggcatcgc caattacctc aatgacttcc aagcccaaca agcccggtac       180
     caactccaag aggaagagcg gatccgacaa aatcaaaaac tgatggacgc gtacggggac       240
     aaggacagtc tgcatgatgt ccagcatgcg ctggaggcct acgagattca gtaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page