(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE228

ASFUM1_6.PE228       Location/Qualifiers
FT   CDS_pept        734987..736564
FT                   /codon_start=1
FT                   /gene_family="HOG000217012" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903119"
FT                   /orf_name="AFUA_6G03430"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85696.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056264"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051FFE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD42"
FT                   /transl_table=1
FT                   /translation="MMDDKHGRYGACDRCRGQKLRCVGAGKPIPNSSSRLLRNEIPCDR
FT                   CRRAKVECYSVRPAPRRAASNVKEQMIATQAASERSSSLAYHTSGPVVSPPNSLVTAAS
FT                   KPHPNSLSFNHPRSDAVAAPGGLQTRRQSRDTDSLGDMPSMPHEWMAYLHDHKMDDRQG
FT                   LGMETPPLIESDLNLSRDPAMDSMHEHNMMMELIHQDHQEEWNSGPPELEAYPDPIVPP
FT                   NPAPLKARKLTSPDCDDYPYGHTRRSSHTPTQPPEPAGRSCIQELAQFNEMLLRDKCSL
FT                   EDTSARRGYKDSWLSIGRTLHHCQQFFSILKRIKYSRPDSQLSADRARSQWSSLPEGTS
FT                   LADGAPTDSPQARRSLARGATPCSSSLARSSSTSSAASTSYLGLSTLLSILFCYTYILQ
FT                   AYEDILTSILHAVTRPTPTIPPTLSGLRIDGFQLDGHHTLQLECLLHVSYNLLEKIENI
FT                   LFGSAGPEELSNPVKYGILGDKLSAGLIDALFEHNETNGLLHCQGKREVAAKRLIREIQ
FT                   AALKQLDL"
     atgatggacg acaagcatgg ccgatacggc gcttgtgacc gatgccgcgg ccaaaagctg        60
     cgatgcgtgg gtgcaggcaa gcccatccca aattccagta gtcgcctcct acgcaatgag       120
     ataccctgtg ataggtgccg gagggcgaaa gttgaatgct atagcgttag gccggccccg       180
     cggagagctg cctcgaatgt caaggagcag atgattgcca cccaggcagc atcggaaagg       240
     tcttcttcgc tggcctatca caccagtggc ccagtcgttt ctcctcccaa cagtctagtc       300
     accgctgcct caaagccaca cccaaacagc ctatcattca accatccgcg cagcgatgcc       360
     gtcgccgcac cgggtggtct gcagacgaga cgacagtccc gcgatacgga ttccttgggt       420
     gacatgccga gcatgcccca cgaatggatg gcctatcttc atgaccataa gatggacgac       480
     agacagggtt tgggtatgga aacgcctccc ctgatcgaat cggatctcaa cttgagtcgg       540
     gatccagcga tggacagcat gcatgagcac aacatgatga tggagctgat ccaccaagac       600
     catcaggagg aatggaactc cggcccaccg gagctggagg cgtacccaga cccgatcgtg       660
     ccgccgaacc cagctccgtt gaaagcccga aagctgacca gcccggactg cgacgactac       720
     ccctatggcc atacgcggcg atcatcacac acaccgacgc aaccgcccga gccagcgggg       780
     cgatcgtgca tacaagagct cgcccagttc aacgagatgt tactgcgcga caaatgcagc       840
     ctggaagata cgtcggcgcg gagaggatac aaggacagtt ggctctccat cgggcggacg       900
     ctgcatcact gtcagcagtt cttttcgatc ctcaagcgga ttaaatactc acgccccgat       960
     tcacaattga gcgcggaccg ggcgaggtca cagtggtcct ccctgccgga gggcaccagc      1020
     ttggccgacg gcgcgccgac agactccccg caggcacgac gaagcctggc gcgtggcgca      1080
     acgccctgct cctcgtccct ggccagatcc tcttcgacct cgtcggcagc gtcgacctcg      1140
     tatctcgggt tgtcgacctt gttgtcgatc ctcttctgct acacctacat cctccaagca      1200
     tacgaagaca ttttaacctc gatcctccac gcggtcactc gccctactcc gactatcccg      1260
     cctacattaa gcgggctccg catcgacggg ttccagctgg atggtcacca cacgcttcag      1320
     ctggagtgtc tcctgcatgt gagctacaac cttctcgaga agattgagaa catattgttc      1380
     gggtcggcag gacccgagga actgtcaaac cccgtgaaat atggcatcct tggagacaaa      1440
     ctgtccgctg gtttgattga cgcgctattc gagcacaatg aaacaaacgg cctcttgcac      1500
     tgccagggaa agagggaggt ggctgccaaa agattgatcc gtgagattca ggctgcactc      1560
     aaacagcttg atctttga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page