(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE235

ASFUM1_6.PE235       Location/Qualifiers
FT   CDS_pept        join(756989..757449,757516..758464)
FT                   /codon_start=1
FT                   /gene_family="HOG000217804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751077"
FT                   /orf_name="AFUA_6G03500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85689.1"
FT                   /db_xref="HOGENOM:HBG056258"
FT                   /db_xref="UniParc:UPI0000520455"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD49"
FT                   /transl_table=1
FT                   /translation="MSGLEILGIAASILQIADLGATVSVKLCTFYRQLKSADQSAQSLS
FT                   SEVALTCSILRQLGENLKQDEQTRLYSAQAFDTAQEVLRECEKVFRRISAAVDESRADA
FT                   TRNALQRAAKRLGFVLMEKELEVLRGNLERLKSTMLLLLNVIMYAGQVRSRAESSVLKE
FT                   QRGLIQVLVEEKKASEARFDQLVKALESADINHHGSGGPDTLPPYEFLAQEDALRELRT
FT                   YHQLVKRLLHEVDACRSGIERSRYARFRNGVVKVHAAEVEGFRRAHGEIVTRLFEDPLF
FT                   SLAPETDTVEAQTPEDDNAEAEGLHRKDAAAKRKRVKLTRHSISPPEASERDRLPLEPS
FT                   GVNYPYAGQIEHSAPSLEVVNERIDADRARDRGFCDYEGTIEGVRPRIGSNTASGRAFG
FT                   RQIRPVVQQQPGQQQQGPPRSEITPLERYMFEVDVIPAPTTKTEDVEEAAETVDDLLLK
FT                   WTTLGQNDLLA"
     atgtccggcc tcgaaatcct cggcatcgca gccagcatcc tgcaaatcgc cgacctcggc        60
     gccaccgtct cagtcaagct atgcaccttc taccgccagc tcaaatccgc cgaccaatcg       120
     gcgcagagcc tctcgagcga ggtcgcgctc acctgcagta ttctccgcca gctaggcgag       180
     aatctcaagc aggacgagca gacgcggctg tattcggcgc aggcgttcga caccgcgcag       240
     gaggtgctgc gcgagtgtga gaaggtgttt cggcggatta gcgcagcggt ggatgagtcg       300
     cgggcggacg cgacgaggaa tgcgctgcag agggcggcga agcggttggg gtttgtgctt       360
     atggagaagg aactggaagt gctgcggggg aatctggaga ggttgaagtc gaccatgttg       420
     ctgttgttga atgtgattat gtatgcgggg caggtgcgga gccgggcgga gtcgtcggtg       480
     ctcaaggaac agaggggttt aatccaggtg ttagtagagg agaagaaggc gagtgaggcg       540
     cgattcgacc agttggtcaa ggccctcgag tctgccgata tcaaccatca cggatcaggt       600
     gggccagata cgctccctcc gtacgagttc ctggcacagg aggatgcttt acgggaactc       660
     cggacatatc accagctcgt caagcggctt ctccacgagg tggatgcgtg ccggtcgggc       720
     attgagcgga gccggtatgc aagattcagg aatggagtgg tcaaggtgca tgcggccgag       780
     gtggagggat ttcgacgggc tcacggggag attgttactc ggctattcga ggatccgctg       840
     tttagtctgg ctcctgaaac ggataccgtc gaggcacaaa ctccggagga tgacaacgcg       900
     gaggctgaag ggctccatcg caaagacgcc gcagcgaagc ggaaacgagt caagctcaca       960
     cgccattcga tctcccctcc cgaggcatct gagagggatc gtctacctct ggagccatcc      1020
     ggcgttaatt acccttacgc tggtcagatc gagcactctg ctccgtcgct tgaagttgtc      1080
     aatgagagaa tcgacgcaga tcgtgcgcgt gaccgaggtt tctgcgacta cgaaggaact      1140
     atcgagggcg tccgtccccg tatcggctct aacacggctt ctggccgtgc tttcgggagg      1200
     cagattcgcc ccgttgtcca gcaacaaccg ggtcagcagc aacagggtcc tcccaggagc      1260
     gaaataacgc cattggaaag atacatgttc gaagtggatg ttatcccagc tccgactacg      1320
     aagacagaag acgttgagga agctgctgag acggtggatg atttgcttct gaaatggacg      1380
     acattagggc agaatgacct cttggcttga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page