(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE237

ASFUM1_6.PE237       Location/Qualifiers
FT   CDS_pept        join(complement(765239..765294),complement(764649..765188),
FT                   complement(764416..764599),complement(764308..764364))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207673"
FT                   /orf_name="AFUA_6G03520"
FT                   /product="Short-chain dehydrogenase/reductase family
FT                   protein, putative"
FT                   /EC_number="1.1.1.47"
FT                   /function="binding"
FT                   /function="glucose 1-dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85687.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0047936"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000051F8CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD51"
FT                   /transl_table=1
FT                   /translation="MASRGRLQGKNAIITGAAGGIGLETSILFAREGANVLMADISAPA
FT                   LEKALAKVKEVVPNAPRVETIKCDVSKESEVQAMVESQDSWGGTDVMFNNAGIMHADDA
FT                   DAVDTPEKIWDLTQNINVKGVWFGCKHAVLSLRRHKKTRGSIINTASVVALVGSATPQL
FT                   AYTASKGAVLALTRELAIVHAREGFRFNALCPAPLNTPLLQDWLGDDQPKRHRREVHFP
FT                   TGRFGEAIEQAHAVVFLASDESSFVNGSDFVVDGGMTKAYVTPEGPATAAPKNLGH"
     atggcttctc gaggaagact ccaaggcaag aatgccatca tcaccggtgc cgcaggtggc        60
     atcggtctcg aaaccagtat cctcttcgct cgcgaaggtg ccaacgtcct gatggccgat       120
     atctccgctc ccgctctcga gaaagccctg gctaaagtca aggaagtcgt ccccaacgcg       180
     ccccgagtcg aaacaatcaa gtgcgatgtc tccaaggaat ctgaagtgca ggccatggtc       240
     gagtcccagg atagctgggg tggaacggac gtgatgttca acaacgcggg gatcatgcac       300
     gctgacgacg ccgatgcggt cgatacacca gagaagatct gggatctgac acagaacatt       360
     aacgtcaagg gtgtctggtt tggctgcaag catgccgtgc tgagtctgcg tcgtcacaag       420
     aagaccaggg gtagcattat caacacggcg agtgtggttg ccctggtggg aagcgcaacg       480
     cctcagctgg cctacacagc cagcaaaggt gctgttctcg ccttgactcg ggagttggct       540
     attgtccatg ctcgtgaagg tttcaggttc aatgctctct gccctgctcc gctcaacacc       600
     cctcttctgc aagactggct aggtgatgac cagcccaagc gtcaccgccg cgaggttcac       660
     ttcccgacag gccggttcgg cgaggccatc gagcaggcgc atgcggtcgt gttccttgcc       720
     agcgacgaga gcagtttcgt caatggaagc gattttgtcg tagatggagg catgaccaag       780
     gcatacgtta cccctgaagg cccggcgact gctgctccta aaaaccttgg ccattga          837
//

If you have problems or comments...

PBIL Back to PBIL home page